Clone Name | bastl16d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SUR1_CAEEL (P39745) Mitogen-activated protein kinase mpk-1 (EC 2... | 29 | 3.8 | 2 | FLIF_CAUCR (Q04954) Flagellar M-ring protein | 28 | 8.5 | 3 | CATV_GVCP (O91466) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cyst... | 28 | 8.5 |
---|
>SUR1_CAEEL (P39745) Mitogen-activated protein kinase mpk-1 (EC 2.7.11.24) (MAP| kinase sur-1) Length = 444 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Frame = +2 Query: 113 WRSRNPSAMPTTRCTTGPATGRPRAT----APGA 202 W N A PTTR P+ G P+AT APG+ Sbjct: 4 WIPNNLCAQPTTRNAKPPSNGHPQATQQQSAPGS 37
>FLIF_CAUCR (Q04954) Flagellar M-ring protein| Length = 536 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 201 APGAVARGRPVAGPVVQRVVGIAEG 127 APG +A P GP V R+V +A+G Sbjct: 444 APGQIALAGPSGGPPVTRLVTLADG 468
>CATV_GVCP (O91466) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 333 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 95 TTGVRCWRSRNPSAMPTTRCTTGPATGRPRATAP 196 TTG R +NPSA T C+ P+A P Sbjct: 92 TTGFRLGLKKNPSAFTMTECSVVVIKDEPQALLP 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.139 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,608,224 Number of Sequences: 219361 Number of extensions: 235597 Number of successful extensions: 1107 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1104 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)