| Clone Name | bastl16d02 |
|---|---|
| Clone Library Name | barley_pub |
>BCAS3_HUMAN (Q9H6U6) Breast carcinoma amplified sequence 3 (GAOB1) (Maab1| protein) Length = 928 Score = 32.0 bits (71), Expect = 0.41 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +1 Query: 52 SGPHRTWWV----RWPIISPSGRVNVIICGRGGTRSRGPCQNPQ 171 +GPHR W+ ++ I PSG+ VI +S GP PQ Sbjct: 732 TGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQ 775
>BCAS3_MOUSE (Q8CCN5) Breast carcinoma amplified sequence 3 homolog (K20D4)| Length = 928 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 52 SGPHRTWWV----RWPIISPSGRVNVIICGRGGTRSRGPCQNPQ 171 +GPHR W+ + I SG+ VI +S GP PQ Sbjct: 732 TGPHRRLWMGPQFHFKTIQTSGQTTVISTSSSVLQSHGPSDTPQ 775
>SYK_SYNEL (Q8DMA9) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase)| (LysRS) Length = 506 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 2 LTWTGSTGDHEGPWPRLVAHIALGGCAGLSSPQVGE*TS 118 +T+ G T D PW R+ H A+ G+ Q+G+ T+ Sbjct: 307 ITYQGETIDLTPPWRRVTMHDAVLAATGIDFRQLGDLTA 345
>YJG6_YEAST (P40364) Hypothetical 28.5 kDa protein in SMC3-MRPL8 intergenic| region Length = 252 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = -2 Query: 167 GFWQG--PRERVPPLPQIMTFTLPLGEMIGQRTH 72 G W+ P + +PPLPQ + F LPL E+ ++H Sbjct: 93 GIWKCLVPSKAIPPLPQ-LDFLLPLEEIKSDKSH 125
>VG69_BPML5 (Q05283) Gene 69 protein (Gp69)| Length = 290 Score = 28.5 bits (62), Expect = 4.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 203 GAICAPAPRSNWGFWQGP 150 GA+C P W FW GP Sbjct: 83 GALCDETPNFEWWFWSGP 100
>Y4KT_RHISN (P55538) Hypothetical protein y4kT| Length = 516 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 54 WPTSHLVGALAYHLPKWESER 116 +PT+H V ALA P+W ER Sbjct: 383 YPTAHAVAALAQGKPQWRDER 403
>Y2149_BRAJA (Q45221) Hypothetical protein blr2149 (ORF7)| Length = 516 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 54 WPTSHLVGALAYHLPKWESER 116 +PT+H V ALA P+W ER Sbjct: 383 YPTAHAVAALAQGKPQWRDER 403
>POLS_EEEV (P08768) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike gl Length = 1239 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -1 Query: 135 PSTTNYDVHSP----TWGDDRPAHPPSAMWATNLGHG 37 P+T N+ V TWG+ HPP +WA G G Sbjct: 633 PTTVNFTVTGEGLEYTWGN----HPPKRVWAQESGEG 665
>POLS_EEEV3 (P27284) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike g Length = 1240 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = -1 Query: 135 PSTTNYDVHSP----TWGDDRPAHPPSAMWATNLGHG 37 P+T N+ V TWG+ HPP +WA G G Sbjct: 634 PTTVNFTVTGEGLEYTWGN----HPPKRVWAQESGEG 666
>IL6RB_MOUSE (Q00560) Interleukin-6 receptor beta chain precursor (IL-6R-beta)| (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (gp130) (CD130 antigen) Length = 917 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 108 SPTWGDDRPAHPPSAMWATNLGHG 37 S T +DRP+ PPS + TN HG Sbjct: 316 SGTTYEDRPSRPPSFWYKTNPSHG 339
>CDSN_PANTR (Q7YR44) Corneodesmosin precursor (S protein)| Length = 529 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 97 PSGRVNVIICGRGGTRSRGPC 159 P G V +CG G T S+GPC Sbjct: 371 PVGTGGVQLCGGGSTGSKGPC 391
>CDSN_HUMAN (Q15517) Corneodesmosin precursor (S protein)| Length = 529 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 97 PSGRVNVIICGRGGTRSRGPC 159 P G V +CG G T S+GPC Sbjct: 371 PVGTGGVQLCGGGSTGSKGPC 391
>DLG5_HUMAN (Q8TDM6) Discs large homolog 5 (Placenta and prostate DLG) (Discs| large protein P-dlg) Length = 1809 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +1 Query: 136 GTRSRGPCQNPQFERGAGAQIAPREHLHLRRRWPASEPMAEEIRRWA 276 G + R P P F + P + L ++ PAS ++ E++ WA Sbjct: 997 GQKRRRPKSAPSFRPKLAPVVIPAQFLEEQKCVPASGELSPELQEWA 1043
>POLG_DEN2P (P12823) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3388 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 70 WWVRWPIISPSGRVNVIICGRGG 138 W+V +++P G+V + CGRGG Sbjct: 2552 WFVERNLVTPEGKVVDLGCGRGG 2574
>CDSN_MACMU (Q5TM45) Corneodesmosin precursor| Length = 534 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 97 PSGRVNVIICGRGGTRSRGPC 159 P G V +CG G T S+GPC Sbjct: 376 PVGTGGVQLCGGGSTGSKGPC 396 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,818,206 Number of Sequences: 219361 Number of extensions: 769021 Number of successful extensions: 2031 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2031 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)