Clone Name | bastl16a01 |
---|---|
Clone Library Name | barley_pub |
>KCNC2_RAT (P22462) Potassium voltage-gated channel subfamily C member 2| (Voltage-gated potassium channel subunit Kv3.2) (KSHIIIA) Length = 638 Score = 32.3 bits (72), Expect = 0.45 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 4 IEGITRGTTRLSPPPQPYRSLAPL-RCAAPIPSVL 105 I G+ RLSP PY S PL R +PIPS+L Sbjct: 604 IAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL 638
>TEP1_HUMAN (Q99973) Telomerase protein component 1 (Telomerase-associated| protein 1) (Telomerase protein 1) (p240) (p80 telomerase homolog) Length = 2627 Score = 32.0 bits (71), Expect = 0.59 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +2 Query: 128 EMAENWVEGSKNTSAPTSFSGSPPGC-HTASTRRSRQRNIFHLLSHREVSPRTKHQAKRH 304 E+ ++ EG KN P P C TA T + Q + + L + +PR KH+AKRH Sbjct: 341 ELYQSLAEGDKNKLVPL------PACLRTAMTDKFAQFDEYQLAKY---NPR-KHRAKRH 390 Query: 305 WNKPP 319 +PP Sbjct: 391 PRRPP 395
>PDE4C_DROME (Q9W4S9) cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 983 Score = 30.0 bits (66), Expect = 2.3 Identities = 34/126 (26%), Positives = 51/126 (40%), Gaps = 9/126 (7%) Frame = +2 Query: 50 NPTARLLLSGAPRRSPQFYFR*I*RTEMAENWVEGSKNTSAPTSFSGS----PPGCHTAS 217 +P+A L+L P+R F +R EM+ + S+N+S + G P + Sbjct: 328 SPSAGLVLQNLPQRRESFLYRSDSDFEMSPKSM--SRNSSIASESHGEDLIVTPFAQILA 385 Query: 218 TRRSRQRNIFHL----LSHREVSPRTKHQAKRHWNKPPA-CGAGYSELRYLATDAKHDLF 382 + RS + N+ L S++ P A R N P A G LATD +L Sbjct: 386 SLRSVRNNLLSLTNVPASNKSRRPNQSSSASRSGNPPGAPLSQGEEAYTRLATDTIEEL- 444 Query: 383 SWAESQ 400 W Q Sbjct: 445 DWCLDQ 450
>Y101_STAAM (Q99XB1) Putative HTH-type transcriptional regulator SAV0101| Length = 745 Score = 29.3 bits (64), Expect = 3.8 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +3 Query: 114 EYKGLKWLKIG*KAQKILLLRRHSLDRPLVV----TPLQQEDQGKGTYFIY*VIERCLLE 281 E+K + I I L+ RH+L RPL++ T G YF +I LL+ Sbjct: 497 EFKTASQMIINKTNYLIDLMHRHNLKRPLILLNWNTLTGDTFITNGEYFRGGIIIEQLLK 556 Query: 282 QNTKLKGIG 308 +TK++GIG Sbjct: 557 LSTKVEGIG 565
>Y097_STAAN (Q7A882) Putative HTH-type transcriptional regulator SA0097| Length = 745 Score = 29.3 bits (64), Expect = 3.8 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +3 Query: 114 EYKGLKWLKIG*KAQKILLLRRHSLDRPLVV----TPLQQEDQGKGTYFIY*VIERCLLE 281 E+K + I I L+ RH+L RPL++ T G YF +I LL+ Sbjct: 497 EFKTASQMIINKTNYLIDLMHRHNLKRPLILLNWNTLTGDTFITNGEYFRGGIIIEQLLK 556 Query: 282 QNTKLKGIG 308 +TK++GIG Sbjct: 557 LSTKVEGIG 565
>YFF9_SCHPO (O14066) Hypothetical serine-rich protein C1687.09 in chromosome I| Length = 1379 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 4 IEGITRGTTRLSPPPQPYRSLAPLRCAAPIPS 99 +E + G ++L+ QP++S PL A P+P+ Sbjct: 323 MERLKNGASKLAIESQPFKSAEPLSSAIPLPN 354
>SYE_METKA (Q8TXB7) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 571 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 20 GERLVSLHPRNPTARLLLSG 79 GER++ LHP N AR LL G Sbjct: 439 GERVLILHPENGVARALLDG 458 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,475,281 Number of Sequences: 219361 Number of extensions: 1279450 Number of successful extensions: 3748 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3737 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)