Clone Name | bastl15h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PROP_CAVPO (Q64181) Properdin precursor (Factor P) | 28 | 4.3 | 2 | PROP_MOUSE (P11680) Properdin precursor (Factor P) | 28 | 5.7 | 3 | SYI1_OCEIH (Q8ER41) Isoleucyl-tRNA synthetase 1 (EC 6.1.1.5) (Is... | 27 | 9.7 |
---|
>PROP_CAVPO (Q64181) Properdin precursor (Factor P)| Length = 470 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 Query: 281 CGIAAVPGRPVHRRRCSATPGSLSRRRAPSTCLW 180 C ++ G + RRC G S +AP T W Sbjct: 88 CSVSCSEGSQLRHRRCIGWGGQCSENKAPGTLEW 121
>PROP_MOUSE (P11680) Properdin precursor (Factor P)| Length = 464 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/60 (25%), Positives = 19/60 (31%) Frame = -2 Query: 281 CGIAAVPGRPVHRRRCSATPGSLSRRRAPSTCLWXXXXXXXRPAVGRLDDPRRRPPEKPC 102 C + G + RRC G S AP T W +P + P PC Sbjct: 85 CSVTCSEGSQLRHRRCVGRGGQCSENVAPGTLEWQLQACEDQPCCPEMGGWSEWGPWGPC 144
>SYI1_OCEIH (Q8ER41) Isoleucyl-tRNA synthetase 1 (EC 6.1.1.5) (Isoleucine--tRNA| ligase 1) (IleRS 1) Length = 918 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 191 YWVPADEREILASQSSGGGEQDGRAPLLYRTFRVKG 298 YW P+ E + ++ QD R+P +Y F VKG Sbjct: 185 YWSPSSESALAEAEIE---YQDKRSPSIYVAFEVKG 217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,014,906 Number of Sequences: 219361 Number of extensions: 669909 Number of successful extensions: 1728 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1728 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)