Clone Name | bastl15f09 |
---|---|
Clone Library Name | barley_pub |
>DPP2_HUMAN (Q9UHL4) Dipeptidyl-peptidase 2 precursor (EC 3.4.14.2)| (Dipeptidyl-peptidase II) (DPP II) (Dipeptidyl aminopeptidase II) (Quiescent cell proline dipeptidase) (Dipeptidyl peptidase 7) Length = 492 Score = 29.6 bits (65), Expect = 1.8 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 252 PPFPFQDETKGRHCVSRWEIVPR 320 P PF DE + R+C+ W + PR Sbjct: 369 PDLPFTDELRQRYCLDTWGVWPR 391
>PSPB_DICDI (P54704) Prespore protein B precursor| Length = 379 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +3 Query: 240 PPQTPPFPFQDETK---GRHC-VSRWEIVPRGPRLDKDLHVPRRPRPNC 374 PP PP D + G HC + WE V R R ++ H P+ P C Sbjct: 215 PPTQPPRASCDNVRCPRGYHCECNHWENVARCVRNEEPTHRPKPPHHGC 263
>DPP2_RAT (Q9EPB1) Dipeptidyl-peptidase 2 precursor (EC 3.4.14.2)| (Dipeptidyl-peptidase II) (DPP II) (Dipeptidyl aminopeptidase II) (Quiescent cell proline dipeptidase) (Dipeptidyl peptidase 7) Length = 500 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 225 DRHHSPPQTPPFPFQDETKGRHCVSRWEIVPR 320 D ++ P PF DE + ++C+ W + PR Sbjct: 370 DSNNVTDMFPEIPFSDELRQQYCLDTWGVWPR 401
>GLYG5_SOYBN (P04347) Glycinin precursor [Contains: Glycinin A3 subunit;| Glycinin B4 subunit] Length = 516 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 219 RPDRHHSPPQTPPFPFQDETKGRHCVSR 302 RPD PPQ P P Q E +GR C +R Sbjct: 319 RPDH---PPQRPSRPEQQEPRGRGCQTR 343
>ZN580_MOUSE (Q9DB38) Zinc finger protein 580| Length = 172 Score = 28.1 bits (61), Expect = 5.3 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 240 PPQTPPFPFQDETKGRHCVSRWEIVPRGPRLDKDL 344 PP+TPPFP + +G S PR PRL + L Sbjct: 23 PPKTPPFP---KAEGPSSTSSSVAGPRPPRLGRHL 54
>S35B1_DROME (Q9VDD7) Solute carrier family 35 member B1 homolog| Length = 338 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 217 QESVALAAAPSGAEAMRLQARWST 146 QE + A+APSG + MR WST Sbjct: 189 QERIRAASAPSGQQMMRAMNFWST 212
>DPP2_MOUSE (Q9ET22) Dipeptidyl-peptidase 2 precursor (EC 3.4.14.2)| (Dipeptidyl-peptidase II) (DPP II) (Dipeptidyl aminopeptidase II) (Quiescent cell proline dipeptidase) (Dipeptidyl peptidase 7) Length = 506 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +3 Query: 225 DRHHSPPQTPPFPFQDETKGRHCVSRWEIVPR 320 D ++ P PF +E + ++C+ W + PR Sbjct: 370 DSNNVTDMFPEIPFSEELRQQYCLDTWGVWPR 401
>ZN696_HUMAN (Q9H7X3) Zinc finger protein 696| Length = 374 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 202 LAAAPSGAEAMRLQARWSTRKVLREGAP 119 LA APSG+ + +QA ST GAP Sbjct: 28 LAQAPSGSRSAEVQAAQSTEPAAEAGAP 55
>ATX2_HUMAN (Q99700) Ataxin-2 (Spinocerebellar ataxia type 2 protein)| (Trinucleotide repeat-containing gene 13 protein) Length = 1312 Score = 27.3 bits (59), Expect = 9.1 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +3 Query: 234 HSPPQ---TPPFPFQDETKGRHCVSRWEIVPRG-PRLDKDLHVPRRPRPN 371 H+PP TPP + G W V G PRL H PR PR N Sbjct: 651 HNPPSEAATPPVARTSPSGGT-----WSSVVSGVPRLSPKTHRPRSPRQN 695 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.132 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,963,911 Number of Sequences: 219361 Number of extensions: 689362 Number of successful extensions: 1629 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1620 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)