| Clone Name | bastl15e03 |
|---|---|
| Clone Library Name | barley_pub |
>SIN3A_MOUSE (Q60520) Paired amphipathic helix protein Sin3a (Transcriptional| corepressor Sin3a) (Histone deacetylase complex subunit Sin3a) Length = 1282 Score = 43.5 bits (101), Expect = 1e-04 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = +1 Query: 175 ELDLSNCQRCTPSYRLLPKNYPVPASSCRTDLGVSVLNDHW 297 E+D ++C+R SYR LPK+Y P + RT L VLND W Sbjct: 546 EIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTW 586
>SIN3A_HUMAN (Q96ST3) Paired amphipathic helix protein Sin3a (Transcriptional| corepressor Sin3a) (Histone deacetylase complex subunit Sin3a) Length = 1273 Score = 43.5 bits (101), Expect = 1e-04 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = +1 Query: 175 ELDLSNCQRCTPSYRLLPKNYPVPASSCRTDLGVSVLNDHW 297 E+D ++C+R SYR LPK+Y P + RT L VLND W Sbjct: 545 EIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTW 585
>PST1_SCHPO (Q09750) Paired amphipathic helix protein pst1 (SIN3 homolog 1)| Length = 1522 Score = 43.1 bits (100), Expect = 2e-04 Identities = 21/44 (47%), Positives = 27/44 (61%) Frame = +1 Query: 166 PISELDLSNCQRCTPSYRLLPKNYPVPASSCRTDLGVSVLNDHW 297 P +DL+ C+ C PSYRLLPK + S R DL ++LND W Sbjct: 584 PRPRVDLTQCKSCGPSYRLLPKIELLLPCSGRDDLCWTILNDAW 627
>SIN3B_MOUSE (Q62141) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1098 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = +1 Query: 175 ELDLSNCQRCTPSYRLLPKNYPVPASSCRTDLGVSVLNDHW 297 E+D ++C+R SYR LPK Y P S RT + VLND W Sbjct: 379 EIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKEVLNDTW 419
>SIN3B_HUMAN (O75182) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1162 Score = 37.0 bits (84), Expect = 0.013 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +1 Query: 175 ELDLSNCQRCTPSYRLLPKNYPVPASSCRTDLGVSVLNDHW 297 E+D ++C+R SYR LPK Y P S RT + + DHW Sbjct: 388 EIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKEL--DHW 426
>SIN3_YEAST (P22579) Paired amphipathic helix protein SIN3| Length = 1536 Score = 35.8 bits (81), Expect = 0.028 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +1 Query: 178 LDLSNCQRCTPSYRLLPKNYPVPASSCRTDLGVSVLNDHW 297 LDL C+ PSY+ LPK+ S R D+ VLND W Sbjct: 743 LDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEW 782
>ASXL1_MOUSE (P59598) Putative Polycomb group protein ASXL1 (Additional sex| combs-like protein 1) Length = 1514 Score = 32.7 bits (73), Expect = 0.24 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 5/101 (4%) Frame = +1 Query: 4 QRDKGRAGEDRERDAE*LSEKERERLDKVSALNSKEATTHKATAFSTKEKYLCKPISELD 183 Q K + + E++A +++ RL+ + + + H TKE+ PI + Sbjct: 514 QETKDQKRKSFEQEASASFPEKKPRLEDRQSFRNTIESVHTEKPQPTKEEPKVPPI-RIQ 572 Query: 184 LSNCQ-----RCTPSYRLLPKNYPVPASSCRTDLGVSVLND 291 LS + + P+Y++ P+ P+ SSCR G L D Sbjct: 573 LSRIKPPWVAKGRPTYQICPRIVPITESSCRGWTGARTLAD 613
>PST2_SCHPO (O13919) Paired amphipathic helix protein pst2 (SIN3 homolog 2)| Length = 1075 Score = 32.3 bits (72), Expect = 0.32 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +1 Query: 187 SNCQRCTPSYRLLPKNYPVPASSCRTDLGVSVLNDHW 297 S+ C PSYRLLP + S R D +LND W Sbjct: 332 SDFPECGPSYRLLPVEERNISCSGRDDFAWGILNDDW 368
>VGLB_BHV1P (P17471) Glycoprotein I precursor (Glycoprotein GVP-6) (Glycoprotein| 11A) (Glycoprotein 16) (Glycoprotein G130) Length = 928 Score = 31.2 bits (69), Expect = 0.70 Identities = 20/72 (27%), Positives = 35/72 (48%) Frame = +1 Query: 13 KGRAGEDRERDAE*LSEKERERLDKVSALNSKEATTHKATAFSTKEKYLCKPISELDLSN 192 + R GE+ E E+ RE + +S +++ E HKA + + L +++L L Sbjct: 852 RNRPGEEEEEFDAAKLEQAREMIKYMSLVSAVERQEHKAKKSNKAARLLATRLTQLALR- 910 Query: 193 CQRCTPSYRLLP 228 +R P Y+ LP Sbjct: 911 -RRAPPEYQQLP 921
>NCOR1_XENLA (Q8QG78) Nuclear receptor corepressor 1 (N-CoR1) (N-CoR) (xN-CoR)| Length = 2498 Score = 30.8 bits (68), Expect = 0.92 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = +1 Query: 1 KQRDKGRAGEDRERDAE*LSEKERERLDKVSALNSKEATTHKATAFSTKEKYLCKPISE 177 ++RD+ R E RER+++ E+ER+RL +A A A S ++ +P+SE Sbjct: 1777 RERDREREKEQRERESD--RERERDRLAHAAA---------AAAAASAPSEHYLRPVSE 1824
>ASXL1_HUMAN (Q8IXJ9) Putative Polycomb group protein ASXL1 (Additional sex| combs-like protein 1) Length = 1541 Score = 30.0 bits (66), Expect = 1.6 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 5/101 (4%) Frame = +1 Query: 4 QRDKGRAGEDRERDAE*LSEKERERLDKVSALNSKEATTHKATAFSTKEKYLCKPISELD 183 Q K + + E+ A +++ RL+ + + + H TKE+ PI + Sbjct: 517 QEPKDQKRKSFEQAASASFPEKKPRLEDRQSFRNTIESVHTEKPQPTKEEPKVPPI-RIQ 575 Query: 184 LSNCQ-----RCTPSYRLLPKNYPVPASSCRTDLGVSVLND 291 LS + + P+Y++ P+ P SSCR G L D Sbjct: 576 LSRIKPPWVVKGQPTYQICPRIIPTTESSCRGWTGARTLAD 616
>POLR_PHMV (P36352) RNA replicase polyprotein (EC 2.7.7.48) (Fragment)| Length = 178 Score = 29.3 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 193 CQRCTPSYRLLPKNYPVPAS 252 C+ CTPS +LL N P+P S Sbjct: 104 CRNCTPSQKLLLSNDPIPES 123
>USH2A_RAT (Q8K3K1) Usherin precursor (Usher syndrome type-2A protein homolog)| (Usher syndrome type IIa protein homolog) Length = 1512 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +1 Query: 79 LDKVSALNSKEATTHKATAFSTKEKY--LCKPISELDLSNCQRCTPSYRLLP 228 +D+++ + + H T T+ Y LC P S + C RC+P Y P Sbjct: 505 VDEITIIGRCQCHGHAETCDRTRRPYRCLCSPHSFTEGPQCGRCSPLYNDKP 556
>CAC1A_DROME (P91645) Voltage-dependent calcium channel type A alpha-1 subunit| (Cacophony protein) (Nightblind A protein) (No-on-transient B protein) (Dmca1A) Length = 1851 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +1 Query: 7 RDKGRAGEDRERDAE*LSEKERERLDKVSALNSKEA 114 RD+ R +RERD E E ERERL+ ++ L+ ++A Sbjct: 1781 RDRERELYERERDRE--REVERERLEYIAPLSFEQA 1814
>BRE1A_HUMAN (Q5VTR2) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 975 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 1 KQRDKGRAGEDRERDAE*LSEKERERLDKVSALNSKEATTHK 126 ++R++ R ++RER+ E EKERER + + KE + K Sbjct: 567 EERERERREKEREREREREKEKEREREKQKLKESEKERDSAK 608
>BCAL2_ARATH (Q9ASR4) Branched-chain-amino-acid aminotransferase-like protein 2| Length = 559 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 115 TTHKATAFSTKEKY-LCKPISELDLSNCQRCTPSYRLL 225 T HK+T FS+ +KY P+ DL ++C P Y +L Sbjct: 196 TLHKSTGFSSPQKYPQTFPLMHYDL--LEQCLPLYNIL 231
>BRE1A_MOUSE (Q5DTM8) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 973 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +1 Query: 1 KQRDKGRAGEDRERDAE*LSEKERERLDKVSALNSKEATTHK 126 ++R++ R ++RER+ E EKERER + + KE + K Sbjct: 565 EERERERREKEREREREREKEKEREREKQKLKESEKERDSVK 606
>ZN330_DROME (Q9VAU9) Zinc finger protein 330 homolog (Nucleolar autoantigen 36| homolog) Length = 315 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/53 (28%), Positives = 21/53 (39%), Gaps = 9/53 (16%) Frame = +1 Query: 148 EKYLCKPISELDLSNCQRCTPSY---------RLLPKNYPVPASSCRTDLGVS 279 E Y C+ ++L +C RC Y KN P+P C D V+ Sbjct: 169 ENYKCQSCNKLGQYSCLRCKTCYCEDHVRRKGFKYDKNKPIPCPKCNYDTSVT 221
>ACINU_HUMAN (Q9UKV3) Apoptotic chromatin condensation inducer in the nucleus| (Acinus) Length = 1341 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 1 KQRDKGRAGEDRERDAE*LSEKERERLDKVSALNSKEATT 120 ++RD+G DRERD E +ER+R D S+ +T Sbjct: 1295 RERDRGDRDRDRERDRE--RGRERDRRDTKRHSRSRSRST 1332
>UVH3_ARATH (Q9ATY5) DNA-repair protein UVH3 (EC 3.1.-.-) (UV hypersensitive| protein 3) (XPG homolog) (ERCC5 homolog) (RAD2 homolog) (AtUVH3) (AtXPG) (AtRAD2) Length = 1479 Score = 27.7 bits (60), Expect = 7.8 Identities = 21/69 (30%), Positives = 31/69 (44%) Frame = +1 Query: 7 RDKGRAGEDRERDAE*LSEKERERLDKVSALNSKEATTHKATAFSTKEKYLCKPISELDL 186 R +GR +D ++ S+ + + DKV L +K A K+T Y K ELD Sbjct: 1278 RGRGRVQKDLLELSDGSSDDDDDD-DKVVELEAKPANLQKSTRSRNPVMYSAKEDDELDE 1336 Query: 187 SNCQRCTPS 213 S +PS Sbjct: 1337 SRSNEGSPS 1345
>VGLB_BHV1C (P12640) Glycoprotein I precursor (Glycoprotein GVP-6) (Glycoprotein| 11A) (Glycoprotein 16) (Glycoprotein G130) (Glycoprotein B) Length = 932 Score = 27.7 bits (60), Expect = 7.8 Identities = 21/67 (31%), Positives = 34/67 (50%) Frame = +1 Query: 28 EDRERDAE*LSEKERERLDKVSALNSKEATTHKATAFSTKEKYLCKPISELDLSNCQRCT 207 E+ E DA L E+ RE + +S +++ E HKA + L +++L L +R Sbjct: 862 EEEEFDAAKL-EQAREMIKYMSLVSAVERQEHKAKKSNKGGPLLATRLTQLALR--RRAP 918 Query: 208 PSYRLLP 228 P Y+ LP Sbjct: 919 PEYQQLP 925 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.131 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,233,199 Number of Sequences: 219361 Number of extensions: 625932 Number of successful extensions: 2344 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2296 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)