| Clone Name | bastl15d12 |
|---|---|
| Clone Library Name | barley_pub |
>FUT4_PANTR (Q659K9) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) Length = 405 Score = 30.8 bits (68), Expect = 1.4 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 14/67 (20%) Frame = -1 Query: 429 SPGGGLRGRRRWVAGRGTP--------AGTR-----TRPAWVPL-PAPWPCDWPSRLRRR 292 SP GRRRW GRG P AG T W L P PW PSR Sbjct: 7 SPTAAAGGRRRWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGV 66 Query: 291 HCWCRPW 271 W P+ Sbjct: 67 LLWWEPF 73
>CYCG_RHOS4 (Q53143) Diheme cytochrome c-type| Length = 296 Score = 30.4 bits (67), Expect = 1.9 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 423 GGGLRGRRRWVAGRGTPAGTRTRPAWVPLPAPW 325 G GLR + RW+AG P G T P P W Sbjct: 211 GLGLRDKSRWLAGGPNPEGRGTIPNITPAKLDW 243
>XYL1_ARATH (Q9S7Y7) Alpha-xylosidase precursor (EC 3.2.1.-)| Length = 915 Score = 28.9 bits (63), Expect = 5.4 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 357 GFGYRLVSLVQRPNGGGLVGLLQV 428 G GYRLVS+ + P+ GG +G LQV Sbjct: 32 GKGYRLVSIEESPD-GGFIGYLQV 54
>XLNR_ASPNG (O42804) Transcriptional activator xlnR| Length = 875 Score = 28.5 bits (62), Expect = 7.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 354 PAWVPLPAPWPCDWPS 307 P W+PLP+P P ++PS Sbjct: 268 PGWLPLPSPSPANFPS 283
>PO5F1_BOVIN (O97552) POU domain, class 5, transcription factor 1| (Octamer-binding transcription factor 3) (Oct-3) (Oct-4) Length = 360 Score = 28.5 bits (62), Expect = 7.1 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 6/57 (10%) Frame = -1 Query: 426 PGG---GLRGRRRWVAGRGTPAGTRTRPAWVPLPAPW---PCDWPSRLRRRHCWCRP 274 PGG G R W++ +G P G+ P VP W PC P L +C P Sbjct: 22 PGGPEPGWVDPRTWMSFQGPPGGSGIGPGVVPGAEVWGLPPCPPPYDLCGGMAYCAP 78
>FUT4_HUMAN (P22083) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) (ELAM-1 ligand fucosyltransferase) Length = 405 Score = 28.1 bits (61), Expect = 9.2 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 14/67 (20%) Frame = -1 Query: 429 SPGGGLRGRRRWVAGRGTP--------AGTR-----TRPAWVPL-PAPWPCDWPSRLRRR 292 SP GRR W GRG P AG T W L P PW PSR Sbjct: 7 SPTAAAGGRRGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGV 66 Query: 291 HCWCRPW 271 W P+ Sbjct: 67 LLWWEPF 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,733,528 Number of Sequences: 219361 Number of extensions: 639402 Number of successful extensions: 2398 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2396 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)