Clone Name | bastl14g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 69 | 4e-12 | 2 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 66 | 2e-11 | 3 | UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3 | 50 | 1e-06 | 4 | UBE1_RABIT (Q29504) Ubiquitin-activating enzyme E1 | 32 | 0.39 | 5 | UBE1_HUMAN (P22314) Ubiquitin-activating enzyme E1 (A1S9 protein) | 32 | 0.39 | 6 | UBE1_MOUSE (Q02053) Ubiquitin-activating enzyme E1 1 | 30 | 1.5 | 7 | UBA1_YEAST (P22515) Ubiquitin-activating enzyme E1 1 | 30 | 1.9 | 8 | UBA1_SCHPO (O94609) Ubiquitin-activating enzyme E1 1 (Poly(A)+ R... | 29 | 3.3 |
---|
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 68.6 bits (166), Expect = 4e-12 Identities = 39/64 (60%), Positives = 40/64 (62%), Gaps = 5/64 (7%) Frame = +2 Query: 170 MLPRKREIVASEVENQQKKXXXXXXXXX-----XXXXXXXXEIDEDLHSRQLAVYGRETM 334 MLPRKREIVA EVE+ QKK EIDEDLHSRQLAVYGRETM Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGEVTREEGDAAMAGRGNEIDEDLHSRQLAVYGRETM 60 Query: 335 KRLF 346 KRLF Sbjct: 61 KRLF 64
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 66.2 bits (160), Expect = 2e-11 Identities = 38/64 (59%), Positives = 39/64 (60%), Gaps = 5/64 (7%) Frame = +2 Query: 170 MLPRKREIVASEVENQQKKXXXXXXXXX-----XXXXXXXXEIDEDLHSRQLAVYGRETM 334 MLPRKREIVA EVE+ QKK EIDEDLHSRQLAVYGRETM Sbjct: 1 MLPRKREIVAGEVEDLQKKTRAGEGEATREEGDAAMAGRGNEIDEDLHSRQLAVYGRETM 60 Query: 335 KRLF 346 K LF Sbjct: 61 KPLF 64
>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3| Length = 1053 Score = 50.1 bits (118), Expect = 1e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +2 Query: 278 EIDEDLHSRQLAVYGRETMKRLFA 349 EIDEDLHSRQLAVYGRETM+RLFA Sbjct: 45 EIDEDLHSRQLAVYGRETMRRLFA 68
>UBE1_RABIT (Q29504) Ubiquitin-activating enzyme E1| Length = 1058 Score = 32.0 bits (71), Expect = 0.39 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +2 Query: 278 EIDEDLHSRQLAVYGRETMKRL 343 +IDE L+SRQL V G E MKRL Sbjct: 49 DIDEGLYSRQLYVLGHEAMKRL 70
>UBE1_HUMAN (P22314) Ubiquitin-activating enzyme E1 (A1S9 protein)| Length = 1058 Score = 32.0 bits (71), Expect = 0.39 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +2 Query: 278 EIDEDLHSRQLAVYGRETMKRL 343 +IDE L+SRQL V G E MKRL Sbjct: 49 DIDEGLYSRQLYVLGHEAMKRL 70
>UBE1_MOUSE (Q02053) Ubiquitin-activating enzyme E1 1| Length = 1058 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +2 Query: 278 EIDEDLHSRQLAVYGRETMKRL 343 +IDE L+SRQL V G E MK L Sbjct: 49 DIDESLYSRQLYVLGHEAMKML 70
>UBA1_YEAST (P22515) Ubiquitin-activating enzyme E1 1| Length = 1024 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +2 Query: 278 EIDEDLHSRQLAVYGRETMKRL 343 EIDE L+SRQL V G+E M ++ Sbjct: 13 EIDESLYSRQLYVLGKEAMLKM 34
>UBA1_SCHPO (O94609) Ubiquitin-activating enzyme E1 1 (Poly(A)+ RNA transport| protein 3) Length = 1012 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 281 IDEDLHSRQLAVYGRETMKRL 343 IDE L+SRQL V G E MK++ Sbjct: 15 IDEGLYSRQLYVLGHEAMKQM 35 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.127 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,618,087 Number of Sequences: 219361 Number of extensions: 283797 Number of successful extensions: 1336 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1334 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)