Clone Name | bastl14c06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RRP44_HUMAN (Q9Y2L1) Exosome complex exonuclease RRP44 (EC 3.1.1... | 79 | 3e-15 | 2 | RRP44_YEAST (Q08162) Exosome complex exonuclease RRP44 (EC 3.1.1... | 53 | 2e-07 | 3 | DIS3_SCHPO (P37202) Mitotic control protein dis3 | 48 | 6e-06 | 4 | RRP44_CAEEL (Q17632) Probable exosome complex exonuclease RRP44 ... | 34 | 0.094 |
---|
>RRP44_HUMAN (Q9Y2L1) Exosome complex exonuclease RRP44 (EC 3.1.13.-) (Ribosomal| RNA-processing protein 44) (DIS3 protein homolog) Length = 958 Score = 78.6 bits (192), Expect = 3e-15 Identities = 42/88 (47%), Positives = 54/88 (61%), Gaps = 12/88 (13%) Frame = +2 Query: 182 MLQSKSFVKKTKQGRVVKVVREHYLRDDIPCGAFSCPSCXXXX------------XXXXX 325 ML+SK+F+KKT+ G V+K+VREHYLRDDI CGA C +C Sbjct: 1 MLKSKTFLKKTRAGGVMKIVREHYLRDDIGCGAPGCAACGGAHEGPALEPQPQDPASSVC 60 Query: 326 XXXXILVVDTNVVLHQIDLLENPAIEDV 409 L+ DTNV+LHQID+LE+PAI +V Sbjct: 61 PQPHYLLPDTNVLLHQIDVLEDPAIRNV 88
>RRP44_YEAST (Q08162) Exosome complex exonuclease RRP44 (EC 3.1.13.-) (Ribosomal| RNA-processing protein 44) (Protein DIS3) Length = 1001 Score = 52.8 bits (125), Expect = 2e-07 Identities = 33/85 (38%), Positives = 40/85 (47%), Gaps = 18/85 (21%) Frame = +2 Query: 194 KSFVKKTKQGRVVKVVREHYLRDDIPCGAFSCPSC------------------XXXXXXX 319 K FV+ ++ G K+VREHYLR DIPC + SC C Sbjct: 22 KVFVR-SRNGGATKIVREHYLRSDIPCLSRSCTKCPQIVVPDAQNELPKFILSDSPLELS 80 Query: 320 XXXXXXILVVDTNVVLHQIDLLENP 394 +V+DTNVVL IDLLENP Sbjct: 81 APIGKHYVVLDTNVVLQAIDLLENP 105
>DIS3_SCHPO (P37202) Mitotic control protein dis3| Length = 970 Score = 47.8 bits (112), Expect = 6e-06 Identities = 29/86 (33%), Positives = 41/86 (47%), Gaps = 17/86 (19%) Frame = +2 Query: 188 QSKSFVKKTKQGRVVKVVREHYLRDDIPCGAFSCPSCXXXX-----------------XX 316 + + FV+ T+ G+V KVVRE YLR+DIPC + +CP C Sbjct: 18 RDRVFVRATR-GKVQKVVREQYLRNDIPCQSRACPLCRSKLPKDSRGNVLEPILSEKPMF 76 Query: 317 XXXXXXXILVVDTNVVLHQIDLLENP 394 L+ D+N+ H ID LE+P Sbjct: 77 LEKFGHHYLIPDSNIFYHCIDALEHP 102
>RRP44_CAEEL (Q17632) Probable exosome complex exonuclease RRP44 (EC 3.1.13.-)| (Ribosomal RNA-processing protein 44) (DIS3 protein homolog) Length = 1029 Score = 33.9 bits (76), Expect = 0.094 Identities = 18/77 (23%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +2 Query: 209 KTKQGRVVKVVREHYLRDDIPCGAFSCPSCXXXXX----------XXXXXXXXILVVDTN 358 + + G+V K E YLR+D+ CG C +C L+VD+ Sbjct: 21 QNRSGKVYKRAEERYLRNDLSCGLAQCGTCKDFGTNPLLKIENPVRNAKVGRHALIVDST 80 Query: 359 VVLHQIDLLENPAIEDV 409 ++ DL ++ + D+ Sbjct: 81 SLIRFYDLFDSSLLRDL 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,776,587 Number of Sequences: 219361 Number of extensions: 218015 Number of successful extensions: 559 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)