| Clone Name | bastl13g02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PANK1_MOUSE (Q8K4K6) Pantothenate kinase 1 (EC 2.7.1.33) (Pantot... | 28 | 6.9 | 2 | YCCR_ECOLI (P75869) Hypothetical protein yccR | 27 | 9.0 |
|---|
>PANK1_MOUSE (Q8K4K6) Pantothenate kinase 1 (EC 2.7.1.33) (Pantothenic acid| kinase 1) (mPank1) (mPank) Length = 548 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 330 LRWQKLWASHQKPGRSCRRHRRWGVGEK 247 L+ Q L+A H P + CR RR G K Sbjct: 154 LQPQPLFAQHDSPAKKCRLRRRMDSGRK 181
>YCCR_ECOLI (P75869) Hypothetical protein yccR| Length = 209 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -2 Query: 384 VSSSECYANQTKYAARYLLRWQKLWASHQKPGRS 283 VS E Y + +A+Y ++ +W +++K GRS Sbjct: 43 VSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRS 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,624,782 Number of Sequences: 219361 Number of extensions: 447618 Number of successful extensions: 1068 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)