| Clone Name | bastl13d06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PYGO1_HUMAN (Q9Y3Y4) Pygopus homolog 1 | 29 | 3.0 | 2 | AEX3_CAEEL (O02626) Regulator of presynaptic activity aex-3 (Abo... | 29 | 3.9 | 3 | SMO_MOUSE (P56726) Smoothened homolog precursor (SMO) | 28 | 5.1 | 4 | SMO_HUMAN (Q99835) Smoothened homolog precursor (SMO) (Gx protein) | 28 | 5.1 | 5 | SMO_RAT (P97698) Smoothened homolog precursor (SMO) | 28 | 6.7 |
|---|
>PYGO1_HUMAN (Q9Y3Y4) Pygopus homolog 1| Length = 419 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 185 EASTQAPEFSPLTNYAAPP 129 +A+TQ P F PL+ YA PP Sbjct: 41 KANTQGPSFPPLSEYAPPP 59
>AEX3_CAEEL (O02626) Regulator of presynaptic activity aex-3 (Aboc, expulsion| defective protein 3) Length = 1409 Score = 28.9 bits (63), Expect = 3.9 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 71 PVTPRELGFTPIRNPPPQEEGALHNSSEGKIQAPELKP 184 PV PRE P RNPPP GA EG P L P Sbjct: 967 PVPPREAPPIPKRNPPPL--GAPPKVPEGARAPPPLPP 1002
>SMO_MOUSE (P56726) Smoothened homolog precursor (SMO)| Length = 793 Score = 28.5 bits (62), Expect = 5.1 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 56 LARRLPVTPRELGFTPIRNPPPQEEGALHNSSEGKIQAPELK 181 +ARR + P+++ TP+ P P EE A E +I +PEL+ Sbjct: 630 VARRGAILPQDVSVTPVATPVPPEEQANMWLVEAEI-SPELE 670
>SMO_HUMAN (Q99835) Smoothened homolog precursor (SMO) (Gx protein)| Length = 787 Score = 28.5 bits (62), Expect = 5.1 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 56 LARRLPVTPRELGFTPIRNPPPQEEGALHNSSEGKIQAPELK 181 +ARR + P+++ TP+ P P EE A E +I +PEL+ Sbjct: 626 VARRGAILPQDISVTPVATPVPPEEQANLWLVEAEI-SPELQ 666
>SMO_RAT (P97698) Smoothened homolog precursor (SMO)| Length = 793 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 56 LARRLPVTPRELGFTPIRNPPPQEEGALHNSSEGKIQAPELK 181 +ARR + P+++ TP+ P P EE A E +I +PEL+ Sbjct: 630 VARRGAILPQDVSVTPVATPVPPEEQANLWLVEAEI-SPELE 670 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,366,738 Number of Sequences: 219361 Number of extensions: 224243 Number of successful extensions: 720 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)