| Clone Name | bastl13c01 |
|---|---|
| Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 33.5 bits (75), Expect(2) = 2e-04 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +3 Query: 408 PQPLKFLRPHYGTLK 452 P+PLKFLRPHYG LK Sbjct: 93 PKPLKFLRPHYGKLK 107 Score = 29.6 bits (65), Expect(2) = 2e-04 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +1 Query: 295 QLELYVVRAQDVDPGVQRLALESMRQEIRSAT 390 +LE+ V R + D + R ALE +R++IRS+T Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSST 86
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 33.5 bits (75), Expect(2) = 2e-04 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +3 Query: 408 PQPLKFLRPHYGTLK 452 P+PLKFLRPHYG LK Sbjct: 93 PKPLKFLRPHYGKLK 107 Score = 29.6 bits (65), Expect(2) = 2e-04 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +1 Query: 295 QLELYVVRAQDVDPGVQRLALESMRQEIRSAT 390 +LE+ V R + D + R ALE +R++IRS+T Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSST 86
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 30.4 bits (67), Expect = 2.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 408 PQPLKFLRPHYGTL 449 P+PLKFLRPHY TL Sbjct: 94 PKPLKFLRPHYFTL 107
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 30.0 bits (66), Expect = 3.2 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +3 Query: 408 PQPLKFLRPHYGTL 449 P+PLKFLRPHY T+ Sbjct: 77 PKPLKFLRPHYETM 90
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 29.6 bits (65), Expect = 4.1 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASP-PAPSPNRIRPASH 137 PT ++ A +PL P A P P P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 29.6 bits (65), Expect = 4.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -2 Query: 121 IRFGDGAGGLARVRGASGTEATRRCCVGVY 32 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 29.6 bits (65), Expect = 4.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASPPAPSPNRIRPA 131 P ++ +A VPLAP +PP+P+P R A Sbjct: 1129 PPKEGVLAQVPLAPPQPGAPPSPAPARFSTA 1159
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 28.9 bits (63), Expect = 7.1 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +3 Query: 39 PTQQRRVASVPLAPRTLASPPAP--SPNRIRPAS 134 PTQQ +VP AP +S PAP SPN I P++ Sbjct: 15 PTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSN 48
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 103 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_HUMAN (Q14203) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) (p135) Length = 1278 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 103 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>PP1RA_RAT (O55000) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (Phosphatase 1 nuclear targeting subunit) (PNUTS protein) (MHC class I region proline-rich protein CAT53) Length = 872 Score = 28.5 bits (62), Expect = 9.2 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = -3 Query: 441 HSVGGGTSEAGDRRHRACS*TNLLPHALEGEPLHAGIHVLRPHDV 307 H GG+ +G R H + H P H G H RPHDV Sbjct: 754 HEGPGGSMGSGHRSHEGPGGSMGSGHRSHEGPGHGGPHGHRPHDV 798
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 28.5 bits (62), Expect = 9.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 8 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 103 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,998,452 Number of Sequences: 219361 Number of extensions: 540178 Number of successful extensions: 2123 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2119 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)