Clone Name | bastl13a08 |
---|---|
Clone Library Name | barley_pub |
>OC17_CHICK (Q9PRS8) Ovocleidin-17 (OC-17)| Length = 142 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 162 GERGREWSSWLVSRAPLWLAGERARADGRCCRLSDSE 52 G R WS R W +AR GRC L D E Sbjct: 84 GSRSWRWSDGTAPRFASWHRTAKARRGGRCAALRDEE 120
>BCSC_SALTY (Q8ZLB8) Cellulose synthase operon protein C| Length = 1143 Score = 26.6 bits (57), Expect(2) = 2.0 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -1 Query: 177 KRALMGERGREWSSWLVSRAPLWLAGERARADGRCCRLSDSE 52 +R L + G W ++ +SR LW AG+ A+AD + L+ + Sbjct: 471 RRRLALDPGSVWVTYRLSR-DLWQAGQHAQADAQMRSLAQQK 511 Score = 21.6 bits (44), Expect(2) = 2.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 311 GRWCRAAESHR 279 G+W +AAE HR Sbjct: 461 GKWAQAAELHR 471
>TRUA_PHOPR (Q6LNU5) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 261 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -1 Query: 204 LLRLVGSGVKRALMGERGREWSSWLVSRAPLWLAGERARADG 79 ++R + + R G+ EW W++ + +AGE A+A G Sbjct: 194 MVRNIAGSLIRVGRGQETPEWMKWVLEQKDRRVAGETAKAAG 235
>TRUA_VIBVY (Q7M7J4) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 264 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 162 GERGREWSSWLVSRAPLWLAGERARADG 79 GE+ EW WL+ LAG A+A+G Sbjct: 208 GEQDPEWIKWLLEAKDRKLAGPTAKAEG 235
>TRUA_VIBVU (Q8CWK3) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 264 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 162 GERGREWSSWLVSRAPLWLAGERARADG 79 GE+ EW WL+ LAG A+A+G Sbjct: 208 GEQDPEWIKWLLEAKDRKLAGPTAKAEG 235
>TRUA_VIBPA (Q87MP1) tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA-uridine| isomerase I) (tRNA pseudouridylate synthase I) Length = 264 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 204 LLRLVGSGVKRALMGERGREWSSWLVSRAPLWLAGERARADG 79 ++R + + + GE EW WL+ LAG A+A+G Sbjct: 194 MVRNITGSLIKVGRGEEKPEWIKWLLEAKDRKLAGATAKAEG 235
>AROC_PROAC (Q6A8I4) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 398 Score = 27.7 bits (60), Expect = 7.6 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 5/41 (12%) Frame = -3 Query: 232 AYGVRSSRGAVATGGQRSEARLNG-----RAREGVEFLVGF 125 AYG+ + G+ + G +R +ARL G +A +GVEF GF Sbjct: 227 AYGLPAGLGSHSQGDRRLDARLAGALMGIQAIKGVEFGDGF 267
>ISPD_GEOSL (Q746Z9) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase| (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) Length = 232 Score = 27.3 bits (59), Expect = 10.0 Identities = 15/29 (51%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -3 Query: 229 YGVRSSRGAVATGGQRSEARLNG-RAREG 146 YG RG VA G +R + LNG RA EG Sbjct: 69 YGFTKVRGIVAGGAERQHSVLNGLRAMEG 97
>IF2_ZYMMO (Q5NQ27) Translation initiation factor IF-2| Length = 989 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 119 ARETNQELHSLPRSPIKARFTPLPTSRNSATR 214 A + +E PRSP RFTP+ R A R Sbjct: 317 APKAREERSESPRSPAPRRFTPVSPPRREAPR 348 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,888,728 Number of Sequences: 219361 Number of extensions: 571969 Number of successful extensions: 1779 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1779 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)