Clone Name | bastl12h05 |
---|---|
Clone Library Name | barley_pub |
>KAS2_STRVN (P16541) Granaticin polyketide putative beta-ketoacyl synthase 2| (EC 2.3.1.-) (ORF2) Length = 415 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 251 YGDGGCLVSAPAELSGMFCRGGGP 322 +G G V+AP L+G C GGGP Sbjct: 320 FGPRGVPVTAPKALTGRLCAGGGP 343
>EBA3_FLAME (P36913) Endo-beta-N-acetylglucosaminidase F3 precursor (EC| 3.2.1.96) (Mannosyl-glycoprotein endo-beta-N-acetyl-glucosaminidase F3) (Di-N-acetylchitobiosyl beta-N-acetylglucosaminidase F3) (Endoglycosidase F3) Length = 329 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 255 EMAGASSLPRPSFPGCSAAAADRWFSSGSA 344 E +GA P P+FPG +A + W+S A Sbjct: 167 EHSGAKPNPIPTFPGYAATGYNGWYSGSMA 196
>DNLI_STRCO (Q9FCB1) Probable DNA ligase (EC 6.5.1.1) (Polydeoxyribonucleotide| synthase [ATP]) Length = 512 Score = 28.5 bits (62), Expect = 4.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -1 Query: 349 QRALPLLNHRSAAAAEHPGKLGRGRDEAPAISVRVE 242 Q LP+L H +++ AE GKLG E +RV+ Sbjct: 182 QPVLPMLAHSASSVAEAVGKLGAAAVEEKLDGIRVQ 217
>GBF3_ARATH (P42776) G-box-binding factor 3 (AtbZIP55)| Length = 382 Score = 28.1 bits (61), Expect = 5.6 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -2 Query: 312 PRQNIPE--SSAGAETRHPPSPYAWN 241 PR +P +SA A + HPP PY WN Sbjct: 42 PRVAMPPYYNSAMAASGHPPPPYMWN 67
>RERE_RAT (Q62901) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-related protein) Length = 1559 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -2 Query: 318 PPPRQNIPESSAGAETRHP-----PSPYAWNAGM 232 PPP IP+ A +HP PSP++ NA + Sbjct: 921 PPPTTPIPQLPAPQAHKHPPHLSGPSPFSMNANL 954
>GAG_SFV1 (Q00071) Gag polyprotein (Core polyprotein)| Length = 647 Score = 27.3 bits (59), Expect = 9.5 Identities = 17/30 (56%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = +3 Query: 261 AGASS---LPRPSFPGCSAAAAD-RWFSSG 338 A ASS P PS P SAAAAD WF+ G Sbjct: 196 AAASSPYVAPAPSAPAASAAAADLGWFAGG 225
>ZAR1_HUMAN (Q86SH2) Zygote arrest 1 (Oocyte-specific maternal effect factor)| Length = 424 Score = 27.3 bits (59), Expect = 9.5 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 234 CLRSTRTEMAGASSLPRPSFPGCSAAAADRWFSS 335 CL ++ AGA+SL SFPGC A +F S Sbjct: 47 CLPASSPCSAGAASL---SFPGCGRLTAAEYFDS 77
>RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-like protein) (Atrophin-1-related protein) Length = 1566 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -2 Query: 318 PPPRQNIPESSAGAETRHP-----PSPYAWNAGM 232 PPP IP+ A +HP PSP++ NA + Sbjct: 930 PPPTTPIPQLPAPQAHKHPPHLSGPSPFSMNANL 963
>RAB21_GEOCY (Q8WQ53) Ras-related protein Rab-21| Length = 229 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 318 PPPRQNIPESSAGAETRHPPS 256 PP PES GA + HPPS Sbjct: 182 PPSSSTPPESQRGAPSSHPPS 202 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,686,810 Number of Sequences: 219361 Number of extensions: 475421 Number of successful extensions: 1924 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1922 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)