Clone Name | bastl12h03 |
---|---|
Clone Library Name | barley_pub |
>RNZ_CAEEL (O44476) Ribonuclease Z (EC 3.1.26.11) (RNase Z) (tRNase Z) (tRNA 3| endonuclease) (Homolog of ELAC2 protein 1) (CeELAC2) Length = 833 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/56 (25%), Positives = 30/56 (53%) Frame = +2 Query: 239 FPRLHATSWNSLVPKSFFHSGRYQEIIQVSHL*VGVDLQQFCIQRITAFGSNPIIH 406 FP LH W+ ++ ++ S R + I+V+ +Q++ ++R +F PI++ Sbjct: 409 FPALHPIDWSGIITQNEELSQRQDQFIRVA------PMQRYWMRRGASFNEEPIVN 458
>MYO52_SCHPO (O94477) Myosin-52 (Myosin type V-2)| Length = 1516 Score = 28.9 bits (63), Expect = 3.0 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -1 Query: 400 DGITPKGSDTLNAELLQIHTHSEVRDLNDLLI 305 +G K DT++ ELL++ T+S+V + DL++ Sbjct: 584 EGFIDKNRDTISDELLELFTNSDVPFVKDLVL 615
>LSHB_GORGO (Q2Q1P1) Lutropin beta chain precursor (Luteinizing hormone beta| subunit) (LSH-beta) (LSH-B) (LH-B) Length = 141 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +2 Query: 26 PPHVSNCDCGAPHDH----NNPSSSSLISL 103 P H S DCG P+DH ++P S L+ L Sbjct: 112 PCHRSTSDCGGPNDHPLTCDHPQLSGLLFL 141
>METB_ECOLI (P00935) Cystathionine gamma-synthase (EC 2.5.1.48) (CGS)| (O-succinylhomoserine (thiol)-lyase) Length = 386 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +1 Query: 94 HLSLRANQSEYNSPYAHAHIGRSNPT---VQKA 183 HLS N + +N P AH + R NPT VQ+A Sbjct: 28 HLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA 60
>GUN_MYTED (P82186) Endoglucanase (EC 3.2.1.4) (Endo-1,4-beta-glucanase)| (Cellulase) (CMCASE) Length = 181 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 2 WNQT*TPYPPHVSNCDCGAPHDHNNPSSS 88 WN T + V NCD HDH PS+S Sbjct: 145 WNNPETTW--EVVNCDSEHNHDHRTPSNS 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,863,774 Number of Sequences: 219361 Number of extensions: 998864 Number of successful extensions: 2609 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2609 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)