| Clone Name | bastl12g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DMI1L_ORYSA (Q75LD5) Putative ion channel DMI1-like, chloroplast... | 30 | 1.1 | 2 | TMPSD_MOUSE (Q5U405) Transmembrane protease, serine 13 (EC 3.4.2... | 28 | 4.1 | 3 | PMT1_YEAST (P33775) Dolichyl-phosphate-mannose--protein mannosyl... | 28 | 4.1 | 4 | COTE1_HUMAN (P81408) COTE1 protein | 28 | 5.3 |
|---|
>DMI1L_ORYSA (Q75LD5) Putative ion channel DMI1-like, chloroplast precursor| Length = 893 Score = 30.4 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 196 VPPFARRGRRVPAASTPSAAPGRRFPRYSSIVAG 297 +PP ++ ++ P +TP AP RR PRY+ + G Sbjct: 66 LPPPEQQKQQQPPPTTPPPAPRRRDPRYAGVRRG 99
>TMPSD_MOUSE (Q5U405) Transmembrane protease, serine 13 (EC 3.4.21.-) (Mosaic| serine protease) (Membrane-type mosaic serine protease) Length = 543 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 190 ARVPPFARRGRRVPAASTPSAAPGRRFPRYS 282 AR PP A R PA + P A+P R P+ S Sbjct: 12 ARTPPQASPARTSPARAPPQASPARTPPQAS 42
>PMT1_YEAST (P33775) Dolichyl-phosphate-mannose--protein mannosyltransferase 1| (EC 2.4.1.109) Length = 817 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 8/48 (16%) Frame = +1 Query: 253 APGRRFPRYSSIVAGPSWRVLHAITR--------KARVMLSSDWQNMV 372 APG + ++ G R+ H +TR K V SSDWQ V Sbjct: 380 APGESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEV 427
>COTE1_HUMAN (P81408) COTE1 protein| Length = 669 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/42 (42%), Positives = 21/42 (50%) Frame = +1 Query: 193 RVPPFARRGRRVPAASTPSAAPGRRFPRYSSIVAGPSWRVLH 318 RVP RG PAA+ P+ AP RRF S + P R H Sbjct: 443 RVP----RGGGRPAAAPPTRAPTRRFSDSSGSLTPPGHRPPH 480 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,043,082 Number of Sequences: 219361 Number of extensions: 543907 Number of successful extensions: 1889 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1888 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)