| Clone Name | bastl12d11 |
|---|---|
| Clone Library Name | barley_pub |
>TNPO3_HUMAN (Q9Y5L0) Transportin 3 (Transportin-SR) (TRN-SR) (Importin 12)| Length = 975 Score = 37.0 bits (84), Expect = 0.011 Identities = 24/67 (35%), Positives = 31/67 (46%) Frame = +2 Query: 125 AVHALNHASHPSARLAANQWLLGLQRSPQAWXXXXXXXXXXDHPAPSVDLLFFAAQMLRR 304 AV AL H PS + A+ WL LQRS AW V+ +FAAQ ++ Sbjct: 14 AVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQ----DVESCYFAAQTMKM 69 Query: 305 MIQSPDY 325 IQ+ Y Sbjct: 70 KIQTSFY 76
>TNPO3_MOUSE (Q6P2B1) Transportin 3| Length = 923 Score = 37.0 bits (84), Expect = 0.011 Identities = 24/67 (35%), Positives = 31/67 (46%) Frame = +2 Query: 125 AVHALNHASHPSARLAANQWLLGLQRSPQAWXXXXXXXXXXDHPAPSVDLLFFAAQMLRR 304 AV AL H PS + A+ WL LQRS AW V+ +FAAQ ++ Sbjct: 14 AVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQ----DVESCYFAAQTMKM 69 Query: 305 MIQSPDY 325 IQ+ Y Sbjct: 70 KIQTSFY 76
>EXTN_SORBI (P24152) Extensin precursor (Proline-rich glycoprotein)| Length = 283 Score = 33.9 bits (76), Expect = 0.096 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +3 Query: 21 PTRIHPPTHAPTSQPPGRQRWTSPSHRTS-RLSSPRPCTHLITPRIPPHV*PPT 179 P PPTH P+ +PP + T P + S + P P T+ TP+ PP PPT Sbjct: 174 PPVTKPPTHTPSPKPP-TSKPTPPVYTPSPKPPKPSPPTYTPTPK-PPATKPPT 225 Score = 33.9 bits (76), Expect = 0.096 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 21 PTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV*PPT 179 P PPT+ P+ +PP + T P+ + P P + +P+ PP PPT Sbjct: 109 PKASTPPTYTPSPKPPATKPPTYPTPKPPATKPPTPPVYTPSPK-PPVTKPPT 160 Score = 33.5 bits (75), Expect = 0.13 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +3 Query: 21 PTRIHPPTHAPTSQPPGRQRWTS-PSHRTSRLSSPRPCTHLITPRIPPHV*PP 176 P + PPT+ PT +PP + TS P+H +P P H T + P PP Sbjct: 204 PPKPSPPTYTPTPKPPATKPPTSTPTHPKPTPHTPYPQAHPPTYKPAPKPSPP 256
>KI13B_HUMAN (Q9NQT8) Kinesin-like protein KIF13B (Kinesin-like protein GAKIN)| Length = 1826 Score = 32.7 bits (73), Expect = 0.21 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRP 128 PPT P +PPG Q+ SP L +P P Sbjct: 1612 PPTAVPAEEPPGPQQLVSPGRERPDLEAPAP 1642
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 32.3 bits (72), Expect = 0.28 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +3 Query: 39 PTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRI---PPH 164 P APT+ PP R SP H R + P P + P + PPH Sbjct: 51 PPSAPTTTPPSRGHVPSPRHAPPRHAYPPPSHGHLPPSVGGPPPH 95
>BAGS_BOMMO (Q9BLJ6) BAG domain-containing protein Samui| Length = 677 Score = 31.6 bits (70), Expect = 0.48 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLIT 146 PP +P QPP ++ T P +T + SS P T +++ Sbjct: 350 PPPKSPQQQPPPQREQTPPQPKTQQPSSNDPITQILS 386
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 31.2 bits (69), Expect = 0.63 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +3 Query: 15 RFPTRIHPP-THAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHL---ITPRIPPHV*PPT 179 + P ++ PP T P +PP + S+P+ ++ TP+ PPHV PP+ Sbjct: 21 KLPPKVKPPSTQPPHVKPPSTPKHPKDPPHVKPPSTPKQPPYVKPPTTPKHPPHVKPPS 79
>KAR9_YEAST (P32526) Karyogamy protein KAR9 (Cortical protein KAR9)| Length = 644 Score = 31.2 bits (69), Expect = 0.63 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPR 152 PPT T P Q W + R +RL P P + L++PR Sbjct: 599 PPTKITT---PNSQVWVPSTRRRTRLRPPTPLSQLLSPR 634
>YNR7_SCHPO (Q9USZ2) Hypothetical protein C11G11.07 in chromosome II| Length = 955 Score = 30.8 bits (68), Expect = 0.82 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = +2 Query: 116 LAAAVHALNHASHPSARLAANQWLLGLQRSPQAWXXXXXXXXXXDHPAPSVDLLFFAAQM 295 L +A+ L + +L AN +L Q+SP AW D S++ FAAQ Sbjct: 4 LLSALATLYANTDREQKLQANNYLEEFQKSPAAWQICFSILNQDD---SSIEAKLFAAQT 60 Query: 296 LRRMI 310 LR+ I Sbjct: 61 LRQKI 65
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 27 RIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPP 161 R H P+ + + P RQ+ TSP R R SP P +P P Sbjct: 521 RRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRRSPSPAP 565 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 15 RFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPR----PCTHLITPRIPP 161 R P+ PP T PP R+R SP R R SPR P +P PP Sbjct: 559 RSPSPAPPPRRRRTPTPPPRRRTPSPPPR-RRSPSPRRYSPPIQRRYSPSPPP 610
>IDI2_CHLCH (Q3AQM4) Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2) (IPP| isomerase) (Isopentenyl pyrophosphate isomerase) Length = 357 Score = 30.0 bits (66), Expect = 1.4 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 80 MDVAESPDIQAQLAAAVHALNHASHPSARLAA-NQWLLGLQ 199 MDVA+S + AQLAA+ L HA H A QWL L+ Sbjct: 295 MDVAKSLAMGAQLAASARHLLHALHAGTLTATIEQWLNDLK 335
>EXTN_MAIZE (P14918) Extensin precursor (Proline-rich glycoprotein)| Length = 267 Score = 29.6 bits (65), Expect = 1.8 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRI------PPHV*PPT 179 PPT+ P+ +PP + T + SP+P T TP PP PPT Sbjct: 71 PPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPT 124 Score = 29.6 bits (65), Expect = 1.8 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRI------PPHV*PPT 179 PPT+ P+ +PP + T + SP+P T TP PP PPT Sbjct: 34 PPTYTPSPKPPASKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPT 87 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV*PPT 179 PPT+ P+ +PP T P P P T+ TP+ PP PPT Sbjct: 212 PPTYTPSPKPPA----TKPP-----TPKPTPPTYTPTPK-PPATKPPT 249 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTS-RLSSPRPCTHLITPR-IPPHV*PPT 179 PPT+ P+ +PP + T P++ S + +P+P TP PP PPT Sbjct: 180 PPTYTPSPKPP-TPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPATKPPT 228 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLIT-PRIPPHV*PPT 179 PPT+ P+ +PP + T + SP+P T T P P PPT Sbjct: 108 PPTYTPSPKPPATKPPTPKPTPPTYTPSPKPPTPKPTPPTYTPSPKPPT 156
>SFRS2_RAT (Q6PDU1) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 22 PPESIHLRTRPPPSRLGGSDGRRR 93 PP+S H R PPP R GG RR Sbjct: 94 PPDSHHSRRGPPPRRYGGGGYGRR 117
>SFRS2_PANTR (Q5R1W5) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 22 PPESIHLRTRPPPSRLGGSDGRRR 93 PP+S H R PPP R GG RR Sbjct: 94 PPDSHHSRRGPPPRRYGGGGYGRR 117
>SFRS2_MOUSE (Q62093) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) (Putative myelin regulatory factor 1) (MRF-1) Length = 220 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 22 PPESIHLRTRPPPSRLGGSDGRRR 93 PP+S H R PPP R GG RR Sbjct: 94 PPDSHHSRRGPPPRRYGGGGYGRR 117
>SFRS2_HUMAN (Q01130) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 220 Score = 29.6 bits (65), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 22 PPESIHLRTRPPPSRLGGSDGRRR 93 PP+S H R PPP R GG RR Sbjct: 94 PPDSHHSRRGPPPRRYGGGGYGRR 117
>SFRS2_CHICK (P30352) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 221 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 22 PPESIHLRTRPPPSRLGGSDGRRR 93 PP+S H R PPP R G S RR Sbjct: 95 PPDSHHSRRGPPPRRYGSSGYGRR 118
>SYP2L_HUMAN (Q9H987) Synaptopodin 2-like protein| Length = 977 Score = 28.9 bits (63), Expect = 3.1 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 5/63 (7%) Frame = +3 Query: 6 ISSRFPTRIHP-----PTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV* 170 +SS+ PT + P+HAP S P R + P TS L P P + P Sbjct: 510 LSSQGPTPLPSFTSGVPSHAPVSGSPSTPRSSGPVTATSSLYIPAPSRPVTPGGAPEPPA 569 Query: 171 PPT 179 PP+ Sbjct: 570 PPS 572
>SGS3_DROME (P02840) Salivary glue protein Sgs-3 precursor| Length = 307 Score = 28.9 bits (63), Expect = 3.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 21 PTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPC 131 PT P T PT+ P + T+ T++ ++P+PC Sbjct: 223 PTTTKPTTTKPTTTKPTTTKPTTTKPTTTKPTTPKPC 259
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 28.9 bits (63), Expect = 3.1 Identities = 24/71 (33%), Positives = 31/71 (43%), Gaps = 14/71 (19%) Frame = +3 Query: 6 ISSRFPTRIHPPTHAPT--SQPPGRQ-------RWTSPSHRTSRLSSPR-----PCTHLI 143 +S R HP + +PT SQ P R+ R SP+ R R SSPR P H Sbjct: 71 LSPRDQPHSHPRSRSPTPRSQSPSRRSVRSPSPRQGSPARRVDRSSSPRARSPPPRRHSR 130 Query: 144 TPRIPPHV*PP 176 +P + PP Sbjct: 131 SPPLRGQPPPP 141 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +3 Query: 12 SRFPTRIHPPTHAPTSQPP---GRQRWTSPSHRTSRLSSPRP 128 SR P+R T +P + PP GR S S SR SP P Sbjct: 814 SRSPSRSRSRTRSPAAAPPIRRGRSGTRSRSRSYSRSPSPPP 855
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 15 RFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPR----PCTHLITPRIPP 161 R P+ PP T PP R+R SP R R SPR P +P PP Sbjct: 573 RSPSPAPPPRRRRTPTPPPRRRTPSPPPR-RRSPSPRRYSPPIQRRYSPSPPP 624
>PEXLP_TOBAC (Q03211) Pistil-specific extensin-like protein precursor (PELP)| Length = 426 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 21 PTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRP---CTHLITPRIPPHV*PP 176 P + P+ +P +QPP +Q P + S L P P ++TP P PP Sbjct: 201 PPPVKAPSPSPATQPPTKQPPPPPRAKKSPLLPPPPPVAYPPVMTPSPSPAAEPP 255
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 9/61 (14%) Frame = +3 Query: 21 PTRIHPPTHA--PTSQPPGRQRWTS-------PSHRTSRLSSPRPCTHLITPRIPPHV*P 173 P +HPP H P +PP + + P H + P P T PPHV P Sbjct: 12 PPIVHPPPHEKPPLFEPPFEKPPPAHPPPVHPPPHEKPPIEYPPPHTKPPIEYPPPHVKP 71 Query: 174 P 176 P Sbjct: 72 P 72
>PACC_ASPPA (Q96UW0) pH-response transcription factor pacC/RIM101| Length = 662 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 9 SSRFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRI-PPH 164 +S P +P TH+PT P T PS S S P + T R+ PPH Sbjct: 394 TSAGPMMANPATHSPTGTP----ALTPPSSAQSYTSGRSPISLPSTSRVSPPH 442
>PACC_ASPOR (Q9HFB3) pH-response transcription factor pacC/RIM101| Length = 662 Score = 28.1 bits (61), Expect = 5.3 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 9 SSRFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRI-PPH 164 +S P +P TH+PT P T PS S S P + T R+ PPH Sbjct: 394 TSAGPIMANPATHSPTGTP----ALTPPSSAQSYTSGRSPISLPSTSRVSPPH 442
>SWR1_GIBZE (Q4IAK7) Helicase SWR1 (EC 3.6.1.-)| Length = 1691 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 22/59 (37%) Frame = +3 Query: 33 HPPTHAPTSQPPGRQRWTSP----------------------SHRTSRLSSPRPCTHLI 143 H P P + PP R TSP H TSR SP+P H I Sbjct: 743 HSPATEPATNPPSRVHSTSPPATSETKPSELDTASTEEMAVDKHDTSRSPSPQPSNHKI 801
>MUC2_HUMAN (Q02817) Mucin-2 precursor (Intestinal mucin 2)| Length = 5179 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV*PPT 179 PPT T+ PP T+PS T+ ++P P T P P + PPT Sbjct: 1588 PPTITTTTPPP----TTTPSPPTTTTTTPPPTTTPSPPTTTP-ITPPT 1630 Score = 27.3 bits (59), Expect = 9.0 Identities = 19/53 (35%), Positives = 23/53 (43%) Frame = +3 Query: 21 PTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV*PPT 179 PT + P+ T PP T P T SSP L T +PP + PPT Sbjct: 1725 PTTMTTPSPTTTPSPPTTTMTTLPPTTT---SSP-----LTTTPLPPSITPPT 1769
>PDXH_RHILO (Q986A0) Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP| oxidase) (PNPOx) Length = 205 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = -2 Query: 303 RRSIWAAKKSRSTEGAG*SAEARSETDSAHACGERCRPRSHWLAAR 166 R WA+K+SR E +A +E + +A GE RP+ HW R Sbjct: 124 RIGAWASKQSRPLESRFALEKAVAEYTARYAIGEIPRPK-HWSGFR 168
>REEP2_MOUSE (Q8VCD6) Receptor expression-enhancing protein 2| Length = 254 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 4 KSPLASPPESIHLRTRPPPSRLGGSD 81 K P A PP S L+TRP GG D Sbjct: 227 KVPRAEPPASKTLKTRPKKKSSGGGD 252
>WBP11_BRARE (Q6P0D5) WW domain-binding protein 11 (WBP-11)| Length = 640 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +3 Query: 36 PPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPP 161 PP+ P PPG + P S L P P L+ P PP Sbjct: 391 PPSGPPPGPPPGAPPFLRPPGLPSALRGPMP--RLLPPGPPP 430
>MTR10_YEAST (Q99189) mRNA transport regulator MTR10| Length = 972 Score = 27.3 bits (59), Expect = 9.0 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +2 Query: 80 MDVAESPDIQAQLAAAVHALNHASHPSARLAANQWLLGLQRSPQAWXXXXXXXXXXDHPA 259 MD + DI+ A+ ++ + + A Q+L QRS AW D Sbjct: 1 MDNLQVSDIET----ALQCISSTASQDDKNKALQFLEQFQRSTVAWSICNEILSKEDPTN 56 Query: 260 PSVDLLFFAAQMLRRMI 310 ++L FAAQ LR + Sbjct: 57 ALLELNIFAAQTLRNKV 73
>CGLH_XANMA (P37126) Chorionicgonadotropic hormone-like protein (CG-like| protein) Length = 443 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = +3 Query: 21 PTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLIT 146 P ++P APT+ P G + S + RT R C H ++ Sbjct: 133 PRGVNPVPSAPTAPPAGLAAFPSANRRTERCLVWIACVHRLS 174
>SPTA3_MOUSE (Q9D9T6) Spermatogenesis-associated protein 3 (Testis spermatocyte| apoptosis-related protein 1) (Testis and spermatogenesis cell-related protein 1) (mTSARG1) Length = 193 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +3 Query: 9 SSRFPTRIHPPTHAPTSQPPGRQRWTSPSHRTSRLSSPRPCTHLITP 149 S R I P T + +SQ P + S S S P+PC TP Sbjct: 11 SRRRRNSISPQTSSDSSQQPSSETPPSCPEPASPPSKPQPCQESTTP 57
>DREB_RAT (Q07266) Drebrin (Developmentally-regulated brain protein)| Length = 706 Score = 27.3 bits (59), Expect = 9.0 Identities = 23/79 (29%), Positives = 27/79 (34%) Frame = +3 Query: 54 TSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV*PPTXXXXXXXXXXXXXXXXXX 233 +S PP HRT LSS PC+HL + R PT Sbjct: 339 SSSPPRTPFPYITCHRTPNLSSSLPCSHLDSHRRMAPTPIPT-------RSPSDSSTAST 391 Query: 234 XXXXXIIRPLPSIYSSSPP 290 I R L + SS PP Sbjct: 392 PITEQIERALDEVTSSQPP 410
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 27.3 bits (59), Expect = 9.0 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 5/51 (9%) Frame = +3 Query: 12 SRFPTRIHPPTHAPTSQPPGRQRWTSPSHRT-----SRLSSPRPCTHLITP 149 SR PT PP +Q GRQR +PS R+ SR SPR ++ +P Sbjct: 744 SRSPT---PPRRQAPAQQRGRQRSYTPSDRSRSRSYSRSRSPRGRSYTRSP 791
>CT111_MOUSE (Q9D722) Protein C20orf111 homolog| Length = 291 Score = 27.3 bits (59), Expect = 9.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 4 KSPLASPPESIHLRTRPPPS 63 KSP+ PP+ IH T PPS Sbjct: 83 KSPVLHPPKFIHCSTTAPPS 102
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 54 TSQPP-GRQRWTSPSHRTSRLSSPRPCTHLITPRIPP 161 T PP +R SH T+ S PRP LI+ PP Sbjct: 509 TMDPPVSEERSVQQSHPTTTTSPPRPYPELISRPSPP 545
>DREB_MOUSE (Q9QXS6) Drebrin (Developmentally-regulated brain protein)| Length = 705 Score = 27.3 bits (59), Expect = 9.0 Identities = 23/79 (29%), Positives = 27/79 (34%) Frame = +3 Query: 54 TSQPPGRQRWTSPSHRTSRLSSPRPCTHLITPRIPPHV*PPTXXXXXXXXXXXXXXXXXX 233 +S PP HRT LSS PC+HL + R PT Sbjct: 341 SSSPPRTPFPYITCHRTPNLSSSLPCSHLDSHRRMAPTPIPT-------RSPSDSSTAST 393 Query: 234 XXXXXIIRPLPSIYSSSPP 290 I R L + SS PP Sbjct: 394 PIAEQIERALDEVTSSQPP 412
>IPO13_RAT (Q9JM04) Importin-13 (Imp13) (Late gestation lung 2 protein)| Length = 963 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 125 AVHALNHASHPSARLAANQWLLGLQRSPQAW 217 A+H L + + + A +WL+ Q SPQAW Sbjct: 29 ALHQLYYDPNIENKNLAQKWLMQAQVSPQAW 59
>IPO13_MOUSE (Q8K0C1) Importin-13 (Imp13)| Length = 963 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 125 AVHALNHASHPSARLAANQWLLGLQRSPQAW 217 A+H L + + + A +WL+ Q SPQAW Sbjct: 29 ALHQLYYDPNIDNKNLAQKWLMQAQVSPQAW 59
>IPO13_HUMAN (O94829) Importin-13 (Imp13) (Ran-binding protein 13) (RanBP13)| (Karyopherin 13) (Kap13) Length = 963 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 Query: 125 AVHALNHASHPSARLAANQWLLGLQRSPQAW 217 A+H L + + + A +WL+ Q SPQAW Sbjct: 29 ALHQLYYDPNIENKNLAQKWLMQAQVSPQAW 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,492,261 Number of Sequences: 219361 Number of extensions: 745989 Number of successful extensions: 3033 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 2694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2995 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)