ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl11h08 |
|---|---|
| Clone Library Name | barley_pub |
>RFFL_HUMAN (Q8WZ73) Rififylin (RING finger and FYVE-like domain-containing| protein 1) (FYVE-RING finger protein Sakura) (Fring) (Caspases-8 and -10-associated RING finger protein 2) (CARP-2) (Caspase regulator CARP2) (RING finger protein 189) (RING finge Length = 363 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 266 SPRAPEXXXXXXXXXXXSLPGSASTMPDSAPTAISIPPAG*QQNR 132 SP PE +P ++ +P S+ A S+PPA Q+N+ Sbjct: 152 SPDFPEQQAFLTQPHSSMVPPTSPNLPSSSAQATSVPPAQVQENQ 196
>Y855_MYCLE (O32965) Hypothetical zinc protease ML0855 (EC 3.4.99.-)| Length = 445 Score = 28.1 bits (61), Expect = 5.7 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 175 GALSGMVEALPGKLAELVQQEYELLSGARGDVAFFQAELR 294 GALS LPG+ A+++Q E+L+ GD +AE R Sbjct: 320 GALSVYAACLPGRFADVMQVISEVLASVAGD-GITEAECR 358
>RTN4R_RAT (Q99M75) Reticulon-4 receptor precursor (Nogo receptor) (NgR)| (Nogo-66 receptor) Length = 473 Score = 27.7 bits (60), Expect = 7.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 114 WICGCRRRRGWAW 76 W+C CR R WAW Sbjct: 262 WVCDCRARPLWAW 274
>RTN4R_MOUSE (Q99PI8) Reticulon-4 receptor precursor (Nogo receptor) (NgR)| (Nogo-66 receptor) Length = 473 Score = 27.7 bits (60), Expect = 7.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 114 WICGCRRRRGWAW 76 W+C CR R WAW Sbjct: 262 WVCDCRARPLWAW 274
>RTN4R_MACFA (Q9N0E3) Reticulon-4 receptor precursor (Nogo receptor) (NgR)| (Nogo-66 receptor) Length = 473 Score = 27.7 bits (60), Expect = 7.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 114 WICGCRRRRGWAW 76 W+C CR R WAW Sbjct: 262 WVCDCRARPLWAW 274
>RTN4R_HUMAN (Q9BZR6) Reticulon-4 receptor precursor (Nogo receptor) (NgR)| (Nogo-66 receptor) Length = 473 Score = 27.7 bits (60), Expect = 7.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 114 WICGCRRRRGWAW 76 W+C CR R WAW Sbjct: 262 WVCDCRARPLWAW 274
>PSTC1_MYCTU (P0A628) Phosphate transport system permease protein pstC-1| Length = 338 Score = 27.7 bits (60), Expect = 7.4 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 166 IAVGALSGMVEALPGKLAELVQQEYELLSG 255 ++VGA +VE LP +LAE V ELL+G Sbjct: 104 VSVGAALVIVERLPKRLAEAVGIVLELLAG 133
>PSTC1_MYCBO (P0A629) Phosphate transport system permease protein pstC-1| Length = 338 Score = 27.7 bits (60), Expect = 7.4 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 166 IAVGALSGMVEALPGKLAELVQQEYELLSG 255 ++VGA +VE LP +LAE V ELL+G Sbjct: 104 VSVGAALVIVERLPKRLAEAVGIVLELLAG 133
>SMG5_MOUSE (Q6ZPY2) Protein SMG5 (SMG-5 homolog) (EST1-like protein B)| Length = 1017 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 16 RHHQPQAGDDEDL 54 RHH P+AGDD DL Sbjct: 463 RHHPPKAGDDSDL 475 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,879,059 Number of Sequences: 219361 Number of extensions: 445575 Number of successful extensions: 1535 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1535 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
