Clone Name | bastl11g03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CBPE_HUMAN (P16870) Carboxypeptidase E precursor (EC 3.4.17.10) ... | 30 | 2.2 | 2 | MUC1_YEAST (P08640) Mucin-like protein 1 precursor | 29 | 3.7 | 3 | PO121_HUMAN (Q9Y2N3) Nuclear envelope pore membrane protein POM ... | 28 | 4.8 | 4 | FTSK1_RALSO (Q8XRH0) DNA translocase ftsK 1 | 28 | 6.3 | 5 | Y220_SILPO (Q5LX20) UPF0247 protein SPO0220 | 28 | 6.3 |
---|
>CBPE_HUMAN (P16870) Carboxypeptidase E precursor (EC 3.4.17.10) (CPE)| (Carboxypeptidase H) (CPH) (Enkephalin convertase) (Prohormone-processing carboxypeptidase) Length = 476 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 18 SLAACVWRLQAIREARGRPARHCRGQRRLRQ 110 +LAAC W L A + G PA R +RRL+Q Sbjct: 15 ALAACGWLLGAEAQEPGAPAAGMRRRRRLQQ 45
>MUC1_YEAST (P08640) Mucin-like protein 1 precursor| Length = 1367 Score = 28.9 bits (63), Expect = 3.7 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +2 Query: 77 APLPRPASSSTVATRHPSSFSFRXXXXXXXXXXXXXXXXSRAP 205 AP+P P+SSS + + PSS F S+ P Sbjct: 864 APVPTPSSSSNITSSAPSSIPFSSTTESFSTGTTVTPSSSKYP 906
>PO121_HUMAN (Q9Y2N3) Nuclear envelope pore membrane protein POM 121 (Pore| membrane protein of 121 kDa) (P145) Length = 1229 Score = 28.5 bits (62), Expect = 4.8 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 10/37 (27%) Frame = -2 Query: 117 VATVEDDAGRGSGAPA----------GLELHVLPAAA 37 +A+V D GRG G PA GL L+++PAAA Sbjct: 17 IASVRDGRGRGCGGPAGAALLGLSLVGLLLYLVPAAA 53
>FTSK1_RALSO (Q8XRH0) DNA translocase ftsK 1| Length = 959 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 59 SSRPAGAPLPRPASSSTVATRHPSSFS 139 +++PA P+P PA++ AT+ PSS S Sbjct: 207 AAQPAPVPVPAPAATPKAATQAPSSRS 233
>Y220_SILPO (Q5LX20) UPF0247 protein SPO0220| Length = 156 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -2 Query: 120 RVATVEDDAGRGSGAPAGLELHVLPAAATHTQLERKTK 7 RV VED G GA A L LPA A L+ + K Sbjct: 40 RVVEVEDKKNAGMGAEAALLRKALPAGAVLCTLDERGK 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,303,993 Number of Sequences: 219361 Number of extensions: 267796 Number of successful extensions: 1202 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1200 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)