ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl11f09 |
|---|---|
| Clone Library Name | barley_pub |
>WAPL_DROME (Q9W517) Protein wings apart-like (Protein parallel sister| chromatids) Length = 1741 Score = 31.6 bits (70), Expect = 0.49 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = +3 Query: 165 PPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDQKRE 344 PPTA DS+ S VGG S D + + +++PNE + E + + D++ E Sbjct: 405 PPTAADSVDGS-SAAVGGASAGDSFEERKSQSLEPNEDEE---------EEEEEEDEEEE 454 Query: 345 SAVQKNCT 368 CT Sbjct: 455 PPEINYCT 462
>TRPA_VIBPA (P22095) Tryptophan synthase alpha chain (EC 4.2.1.20)| Length = 268 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +3 Query: 162 APPTAIDSIVQSIKEVVGGH----SEADILDALRESNMDPNETAQKL 290 APPTA D ++ + E+ GG+ S A + A ++NM + +KL Sbjct: 154 APPTASDETLKQVSELGGGYTYLLSRAGVTGAETKANMPVDHMLEKL 200
>KPC1_LYTPI (Q25378) Protein kinase C (EC 2.7.11.13)| Length = 658 Score = 28.9 bits (63), Expect = 3.2 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 204 EVVGGHSEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDQKRES 347 EV+G + + +A MDPN + DPF ++K DQKRE+ Sbjct: 158 EVIGNKLQVTVAEAKNLIPMDPNGLS------DPFVKLKLIPDQKRET 199
>CUT7_SCHPO (P24339) Kinesin-like protein cut7 (Cell untimely torn protein 7)| Length = 1085 Score = 28.9 bits (63), Expect = 3.2 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = +3 Query: 165 PPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDQK 338 P +++D IV +K+ S+ +LDAL S D + ++QKL N ++ ++D K Sbjct: 675 PNSSLDLIVSELKD-----SKNSLLDALEHSLQDISMSSQKLGNGISSELIELQKDMK 727
>SM3L2_ARATH (Q9FNI6) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3-like 2 (EC 3.6.1.-) (SMARCA3-like protein 2) Length = 1029 Score = 28.5 bits (62), Expect = 4.1 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 180 DSIVQSIKEVVGG-HSEADILDALRESNMDPNETAQKLLNQDPF 308 D +V +++ VVG +S+ DI+ AL +N DP + + F Sbjct: 7 DDLVSTVRSVVGSDYSDMDIIRALHMANHDPTAAINIIFDTPSF 50
>TENA_BACSU (P25052) Thiaminase-2 (EC 3.5.99.2) (Thiaminase II)| (Transcriptional activator tenA) Length = 236 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = +3 Query: 144 DTKAARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQDPFHEVKR 323 + KA + PTA + V+ G+ A+IL AL E +KLL+ DP H + + Sbjct: 99 ERKAFKPSPTAYSYTSHMYRSVLSGNF-AEILAALLPCYWLYYEVGEKLLHCDPGHPIYQ 157 Query: 324 K 326 K Sbjct: 158 K 158
>CSTF3_PONPY (Q5RDW9) Cleavage stimulation factor, 77 kDa subunit (CSTF 77 kDa| subunit) (CF-1 77 kDa subunit) (CstF-77) Length = 717 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 222 SEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDQKR 341 S A + A++ N D +E +K P H++ R R QKR Sbjct: 676 SNAVLTKAVKRPNEDSDEDEEKGAVVPPVHDIYRARQQKR 715
>CSTF3_MOUSE (Q99LI7) Cleavage stimulation factor, 77 kDa subunit (CSTF 77 kDa| subunit) (CF-1 77 kDa subunit) (CstF-77) Length = 717 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 222 SEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDQKR 341 S A + A++ N D +E +K P H++ R R QKR Sbjct: 676 SSAVLTKAVKRPNEDSDEDEEKGAVVPPVHDIYRARQQKR 715
>CSTF3_HUMAN (Q12996) Cleavage stimulation factor, 77 kDa subunit (CSTF 77 kDa| subunit) (CF-1 77 kDa subunit) (CstF-77) Length = 717 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 222 SEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDQKR 341 S A + A++ N D +E +K P H++ R R QKR Sbjct: 676 SNAVLTKAVKRPNEDSDEDEEKGAVVPPVHDIYRARQQKR 715
>GLYA_RICCN (Q92GH7) Serine hydroxymethyltransferase (EC 2.1.2.1) (Serine| methylase) (SHMT) Length = 420 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +3 Query: 207 VVGGHSEADILDALRESNMDPNETAQKLLNQ 299 V+ GH ADILD L+ +N D + QK+LN+ Sbjct: 379 VLVGHMVADILDGLK-NNEDNSALEQKVLNE 408
>SYR_VIBCH (Q9KQC6) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 577 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +3 Query: 150 KAARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLN 296 +AA AP + QS K G + I+ A ++ +P E AQK+L+ Sbjct: 16 EAAGAPAGTPALVRQSAKAQFGDYQANGIMGAAKQLGTNPREFAQKVLD 64
>TRPA_VIBVY (Q7MM57) Tryptophan synthase alpha chain (EC 4.2.1.20)| Length = 268 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = +3 Query: 162 APPTAIDSIVQSIKEVVGGH----SEADILDALRESNMDPNETAQKL 290 APPTA D ++ + ++ GG+ S A + A ++NM + KL Sbjct: 154 APPTASDETLKQVSQLGGGYTYLLSRAGVTGAETKANMPVGDMLAKL 200
>TRPA_VIBVU (Q8D8B1) Tryptophan synthase alpha chain (EC 4.2.1.20)| Length = 268 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = +3 Query: 162 APPTAIDSIVQSIKEVVGGH----SEADILDALRESNMDPNETAQKL 290 APPTA D ++ + ++ GG+ S A + A ++NM + KL Sbjct: 154 APPTASDETLKQVSQLGGGYTYLLSRAGVTGAETKANMPVGDMLAKL 200
>ACON2_ECOLI (P36683) Aconitate hydratase 2 (EC 4.2.1.3) (Citrate hydro-lyase 2)| (Aconitase 2) Length = 865 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 3/70 (4%) Frame = +3 Query: 156 ARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDP---NETAQKLLNQDPFHEVKRK 326 A++P + ++ + + GG++ ++DAL ++ + P + LL D F++V+ K Sbjct: 76 AKSPLLTPEKAIELLGTMQGGYNIHPLIDALDDAKLAPIAAKALSHTLLMFDNFYDVEEK 135 Query: 327 RDQKRESAVQ 356 E A Q Sbjct: 136 AKAGNEYAKQ 145
>THE2_GEOSL (P61411) Putative thiamine-phosphate pyrophosphorylase (EC 2.5.1.3)| (TMP pyrophosphorylase) (TMP-PPase) (Thiamine-phosphate synthase) Length = 213 Score = 27.7 bits (60), Expect = 7.0 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 18/67 (26%) Frame = +3 Query: 147 TKAARAPPTAIDSIVQSIKEV------VGGHSEADILDALRE------------SNMDPN 272 +KAA P ID + + KE+ +GG EA+I +AL ++ DP Sbjct: 137 SKAAYGEPVGIDQLAATTKEIHIPVFALGGIKEANIPEALAAGAAGVALISAIIADPDPR 196 Query: 273 ETAQKLL 293 E A+ LL Sbjct: 197 ERARALL 203
>TRPA_VIBME (Q9RCE7) Tryptophan synthase alpha chain (EC 4.2.1.20)| Length = 268 Score = 27.3 bits (59), Expect = 9.2 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +3 Query: 162 APPTAIDSIVQSIKEVVGGH----SEADILDALRESNMDPNETAQKL 290 APPTA D +QS+ E+ G+ S + + A ++NM + ++L Sbjct: 152 APPTASDETLQSVAELGSGYTYLLSRSGVTGAETKANMPVHALLERL 198
>SYR_VIBVY (Q7MMM3) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 577 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +3 Query: 150 KAARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLN 296 +AA AP + ++ QS K G + ++ ++ +P E AQK+L+ Sbjct: 16 EAAGAPTGSPAAVRQSAKPQFGDYQANGVMGVAKQLGTNPREFAQKVLD 64
>SYR_VIBVU (Q8DFR1) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 577 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +3 Query: 150 KAARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLN 296 +AA AP + ++ QS K G + ++ ++ +P E AQK+L+ Sbjct: 16 EAAGAPAGSPAAVRQSAKPQFGDYQANGVMGVAKQLGTNPREFAQKVLD 64
>YMWB_CAEEL (Q09385) Hypothetical protein K04G7.11| Length = 234 Score = 27.3 bits (59), Expect = 9.2 Identities = 19/65 (29%), Positives = 27/65 (41%) Frame = +3 Query: 147 TKAARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQDPFHEVKRK 326 T+ A +DS + ++E VGG D L N P A L +D +VKR+ Sbjct: 126 TRLTAALDPDLDSY-KKMRECVGGEQFYPTADTLIHGNHYPTTAAMDKLTKDVHGQVKRR 184 Query: 327 RDQKR 341 R Sbjct: 185 EQYHR 189
>ATCL_SYNP7 (P37278) Cation-transporting ATPase pacL (EC 3.6.3.-)| Length = 926 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +3 Query: 207 VVGGHSEADILDALRESNMDPNETAQKLLNQDPFHEVKRKRDQKRESAVQKNCTETT 377 +VG +E +L ++ +DP + L QD E+ ++KR S V + ETT Sbjct: 421 IVGDPTEGSLLTVAAKAGIDPEGLQRVLPRQD---EIPFTSERKRMSVVVADLGETT 474
>Y1427_HALMA (P20191) Hypothetical protein rrnAC1427| Length = 369 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 147 TKAARAPPTAIDSIVQSIKEVVGGHSE-----ADILDAL 248 T APP A D++ ++++ GG E AD+LDA+ Sbjct: 197 TVTTDAPPRAADAVQRALRPTAGGPFETVGGYADVLDAV 235
>PRSA_STAES (Q8CNR4) Foldase protein prsA precursor (EC 5.2.1.8)| Length = 325 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +3 Query: 144 DTKAARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQ 299 + K + P D+ + +KE + + DI A+ +S +DP++ Q+ Q Sbjct: 262 EEKVQKKPKLLTDAYKELLKEYKVDYKDRDIKKAIEDSILDPDKIKQQQQQQ 313
>PRSA_STAEQ (Q5HN96) Foldase protein prsA precursor (EC 5.2.1.8)| Length = 325 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = +3 Query: 144 DTKAARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQ 299 + K + P D+ + +KE + + DI A+ +S +DP++ Q+ Q Sbjct: 262 EEKVQKKPKLLTDAYKELLKEYKVDYKDRDIKKAIEDSILDPDKIKQQQQQQ 313
>GLPK_CHRVO (Q7P1G2) Glycerol kinase (EC 2.7.1.30) (ATP:glycerol| 3-phosphotransferase) (Glycerokinase) (GK) Length = 500 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +3 Query: 147 TKAARAPPTAIDSIVQSIKEVVGGHSEADILDALRESNMDPNETAQKLLNQ 299 TKAA A+DSI ++V+ EAD ++ E +D T +LL Q Sbjct: 370 TKAAHIARAALDSIAYQTRDVLKA-MEADAGMSIAELRVDGGATVNELLMQ 419 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,370,516 Number of Sequences: 219361 Number of extensions: 387148 Number of successful extensions: 1824 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1822 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
