Clone Name | bastl11d12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1536_PSEAE (Q9I3H7) Hypothetical UPF0167 protein PA1536 | 29 | 2.5 | 2 | SYFA_HUMAN (Q9Y285) Phenylalanyl-tRNA synthetase alpha chain (EC... | 28 | 7.3 |
---|
>Y1536_PSEAE (Q9I3H7) Hypothetical UPF0167 protein PA1536| Length = 179 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 220 PRRRPHPHIMASGFSTASSTQISCCASTAG 309 P R HP +ASG AS+T CC G Sbjct: 6 PHFRYHPEPLASGSIEASATTCQCCGKARG 35
>SYFA_HUMAN (Q9Y285) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) (CML33) Length = 507 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 197 LCRLLAHPRPPPERDEA 147 LCRL A PRPPP ++ A Sbjct: 491 LCRLDAEPRPPPTQEAA 507 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.118 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,165,518 Number of Sequences: 219361 Number of extensions: 237767 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)