Clone Name | bastl11c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GUN_MYTED (P82186) Endoglucanase (EC 3.2.1.4) (Endo-1,4-beta-glu... | 30 | 1.8 | 2 | TPP1_RAT (Q9EQV6) Tripeptidyl-peptidase 1 precursor (EC 3.4.14.9... | 28 | 6.8 | 3 | LSHB_GORGO (Q2Q1P1) Lutropin beta chain precursor (Luteinizing h... | 27 | 8.8 | 4 | METB_ECOLI (P00935) Cystathionine gamma-synthase (EC 2.5.1.48) (... | 27 | 8.8 |
---|
>GUN_MYTED (P82186) Endoglucanase (EC 3.2.1.4) (Endo-1,4-beta-glucanase)| (Cellulase) (CMCASE) Length = 181 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 32 GWNQT*TPYPPHVSNCDCGAPHDHNNPSSS 121 GWN T + V NCD HDH PS+S Sbjct: 144 GWNNPETTW--EVVNCDSEHNHDHRTPSNS 171
>TPP1_RAT (Q9EQV6) Tripeptidyl-peptidase 1 precursor (EC 3.4.14.9)| (Tripeptidyl-peptidase I) (TPP-I) (Tripeptidyl aminopeptidase) Length = 563 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 Query: 215 HRRPPLTWKREREQPRGEGFPRLH 286 HR PPL+ R+R +P+G G LH Sbjct: 174 HRFPPLSSPRQRPEPQGVGPVGLH 197
>LSHB_GORGO (Q2Q1P1) Lutropin beta chain precursor (Luteinizing hormone beta| subunit) (LSH-beta) (LSH-B) (LH-B) Length = 141 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = +2 Query: 59 PPHVSNCDCGAPHDH----NNPSSSSLISL 136 P H S DCG P+DH ++P S L+ L Sbjct: 112 PCHRSTSDCGGPNDHPLTCDHPQLSGLLFL 141
>METB_ECOLI (P00935) Cystathionine gamma-synthase (EC 2.5.1.48) (CGS)| (O-succinylhomoserine (thiol)-lyase) Length = 386 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +1 Query: 127 HLSLRANQSEYNSPYAHAHIGRSNPT---VQKA 216 HLS N + +N P AH + R NPT VQ+A Sbjct: 28 HLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.129 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,630,022 Number of Sequences: 219361 Number of extensions: 963149 Number of successful extensions: 2486 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2486 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)