Clone Name | bastl11b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLT1_SCHPO (Q9C102) Putative glutamate synthase [NADPH] (EC 1.4.... | 28 | 8.2 |
---|
>GLT1_SCHPO (Q9C102) Putative glutamate synthase [NADPH] (EC 1.4.1.13)| (NADPH-GOGAT) Length = 2111 Score = 27.7 bits (60), Expect = 8.2 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 11/53 (20%) Frame = +1 Query: 1 LISFPPHHHIARVSD----FVDRKKASLRP-------SELELGLLSLAVASSK 126 LIS PPHH I + D D K A+ R SE+ +G+++ VA +K Sbjct: 1055 LISPPPHHDIYSIEDLKQLIYDMKSANPRARVSVKLVSEVGVGIVASGVAKAK 1107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,381,860 Number of Sequences: 219361 Number of extensions: 560948 Number of successful extensions: 1911 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1911 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)