Clone Name | bastl11b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-ass... | 28 | 8.0 |
---|
>RIMB1_MOUSE (Q7TNF8) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1846 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 93 LLLLRPSIKDCLSPLQRGVPQGTRTLATALI*QRRVHTGQEQGPIPC 233 L + P + D PL+ VP GT+ + +L + QE+ P+PC Sbjct: 1098 LASVSPGLGDTSFPLRHPVPHGTQDFSASLSIEMS-KGPQEEPPVPC 1143 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,140,597 Number of Sequences: 219361 Number of extensions: 667714 Number of successful extensions: 1528 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1528 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)