Clone Name | bastl11b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LAC1_CRYPA (Q03966) Laccase precursor (EC 1.10.3.2) (Benzenediol... | 30 | 1.3 | 2 | NUCKS_MOUSE (Q80XU3) Nuclear ubiquitous casein and cyclin-depend... | 28 | 4.9 | 3 | ROX1_YEAST (P25042) ROX1 repressor (Hypoxic function repressor) ... | 28 | 6.4 |
---|
>LAC1_CRYPA (Q03966) Laccase precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) Length = 591 Score = 30.4 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = -3 Query: 153 NLFRCVSLILFSPQLRRSLP--LHPWDPRRSPNQHTATHR 40 + FR + L + QL + P LHP +PR+ PN +TA++R Sbjct: 3 SFFRALFSGLIASQLSWAAPSLLHPLEPRQQPNCNTASNR 42
>NUCKS_MOUSE (Q80XU3) Nuclear ubiquitous casein and cyclin-dependent kinases| substrate (JC7) Length = 234 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 37 SAVSGGVLIGRPAGVPRMKRKTPSELRGEQYKRHTSEKIADDQ 165 S V G +GRP + K KTPS ++ EK + D+ Sbjct: 181 SPVKGKAKVGRPTASKKSKEKTPSPKEEDEEAESPPEKKSGDE 223
>ROX1_YEAST (P25042) ROX1 repressor (Hypoxic function repressor)| (Heme-dependent repression factor) Length = 368 Score = 28.1 bits (61), Expect = 6.4 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = -2 Query: 172 QITDHQQSFQMCVSYIVLPAAXXXXXXXXXXXXXXXXSTHRHSPQIQQQPVPL 14 Q+ +QQ QM +YIV P + TH H P I Q +PL Sbjct: 300 QLDQYQQLKQMGPTYIVKPLSHTRNNLLSTTTP-----THHHIPHIPNQNIPL 347 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.313 0.130 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,654,791 Number of Sequences: 219361 Number of extensions: 537106 Number of successful extensions: 1377 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1377 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)