Clone Name | bastl11a12 |
---|---|
Clone Library Name | barley_pub |
>RNR_MYCGE (P47350) Ribonuclease R (EC 3.1.-.-) (RNase R) (VacB protein| homolog) Length = 725 Score = 30.8 bits (68), Expect = 0.91 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +2 Query: 143 LTPLTLVSSSSFSAVWVNHHLNQSKGVRSRTTVVIQNPASYALSDL 280 L P T++S + FS VN LN + TV+ A++ LSDL Sbjct: 374 LYPATIISKNRFSYDQVNKWLNNKSELNCDETVINSLKAAFTLSDL 419
>WIRE_MOUSE (Q6PEV3) WIP-related protein (WASP-interacting protein-related| protein) Length = 440 Score = 25.4 bits (54), Expect(2) = 1.3 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 196 PPPQPIQGSEEQNHRRHPKPCFLCPLRPP 282 PPP + GSE + + P P P PP Sbjct: 343 PPPYRMHGSEPPSRGKPPPPPSRTPAGPP 371 Score = 23.5 bits (49), Expect(2) = 1.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 3 ASTKPHSGTPSLLDNSTPFHPLHLPPN 83 A P S TPSLL N P P PP+ Sbjct: 295 APPPPTSATPSLLSNRPP-PPAREPPS 320
>LRP2_HHV1F (P17589) Latency-related protein 2| Length = 107 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +3 Query: 15 PHSGTPSLLDNSTPFHP-LHLPPNSLRY 95 PHS P L TP HP H PP S+++ Sbjct: 30 PHSHAPPLPRTPTPTHPHSHAPPRSIQH 57
>RANB9_HUMAN (Q96S59) Ran-binding protein 9 (RanBP9) (RanBP7) (Ran-binding| protein M) (RanBPM) (BPM90) (BPM-L) Length = 729 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +1 Query: 190 GEPPPQPIQGSEEQNHRRHPKPCFLCPL 273 G+PPP P Q ++Q P P L P+ Sbjct: 3 GQPPPPPPQQQQQQQQLSPPPPAALAPV 30
>POLR_TYMVC (P28477) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1844 Score = 28.5 bits (62), Expect = 4.5 Identities = 34/103 (33%), Positives = 45/103 (43%), Gaps = 7/103 (6%) Frame = +1 Query: 16 PTLAHPPSLITA-LPFILSICLPTPFDTLGYQRGSNLIHS*LCSDSTHSRIFVKL*RGLG 192 P L P L A P LSI P D++ GS+L+H L + TH +L Sbjct: 677 PQLPATPDLEPAHTPPPLSIPHQDPTDSVDPLMGSHLLHHSLPAPPTHPLPSSQLLPAPL 736 Query: 193 EPPPQ---PIQGSEEQNHRRHPK--PCFLCPLRP-PCYHMPLP 303 P P+ EE + RR+P+ FL LR P H+P P Sbjct: 737 TNDPTAIGPVLPFEELHPRRYPENTATFLTRLRSLPSNHLPQP 779
>POLR_TYMV (P10358) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1844 Score = 27.7 bits (60), Expect = 7.7 Identities = 34/103 (33%), Positives = 44/103 (42%), Gaps = 7/103 (6%) Frame = +1 Query: 16 PTLAHPPSLITA-LPFILSICLPTPFDTLGYQRGSNLIHS*LCSDSTHSRIFVKL*RGLG 192 P L P L A P LSI P D+ GS+L+H L + TH +L Sbjct: 677 PQLPATPDLEPAHTPPPLSIPHQDPTDSADPLMGSHLLHHSLPAPPTHPLPSSQLLPAPL 736 Query: 193 EPPPQ---PIQGSEEQNHRRHPK--PCFLCPLRP-PCYHMPLP 303 P P+ EE + RR+P+ FL LR P H+P P Sbjct: 737 TNDPTAIGPVLPFEELHPRRYPENTATFLTRLRSLPSNHLPQP 779
>FETUA_SHEEP (P29701) Alpha-2-HS-glycoprotein precursor (Fetuin-A)| Length = 364 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 27 TPSLLDNSTPFHPLHLPPNSLRYFRI 104 TP + S P P+HL P +RYF+I Sbjct: 339 TPIVGQPSVPGGPVHLCPGRIRYFKI 364 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,236,643 Number of Sequences: 219361 Number of extensions: 967397 Number of successful extensions: 3500 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3494 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)