Clone Name | bastl10h05 |
---|---|
Clone Library Name | barley_pub |
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 224 DVHEPVRGQYDFEGRNDLV 280 + HEP R QYDF G DLV Sbjct: 80 NAHEPSRRQYDFSGNLDLV 98
>ZBT38_RAT (Q5EXX3) Zinc finger and BTB domain-containing protein 38 (Zinc| finger protein expressed in neurons) (Zenon) Length = 1203 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 12 SSPTLHSTSTALLARLVHRTPSSHEQGAVLVAVSSQESDKAMAAVGR 152 SS HS + A LA H++PS L+ S E+DKA R Sbjct: 716 SSVIKHSNAIACLANSNHQSPSQPVASPSLIKDSKPEADKASKLASR 762
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +2 Query: 230 HEPVRGQYDFEGRNDLV 280 HEP G+Y FEGR DLV Sbjct: 86 HEPSEGKYYFEGRYDLV 102
>TTGH_PSEPU (Q93PU4) Toluene efflux pump membrane transporter ttgH| Length = 1049 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 126 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 40 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145
>SRPB_PSEPU (O31100) Solvent resistant pump membrane transporter srpB| Length = 1049 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = -1 Query: 126 RSPEKKQRQGLHLVRGMMAFGVLAELVAR 40 R PE+ QRQGL +V+ M F ++ LV R Sbjct: 117 RLPEEVQRQGLRVVKYQMNFFLVMSLVDR 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,108,313 Number of Sequences: 219361 Number of extensions: 331637 Number of successful extensions: 1394 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1394 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)