Clone Name | bastl10g04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GP2_HUMAN (P55259) Pancreatic secretory granule membrane major g... | 27 | 9.4 | 2 | HB24_MOUSE (P20040) H-2 class II histocompatibility antigen, E-Q... | 27 | 9.4 |
---|
>GP2_HUMAN (P55259) Pancreatic secretory granule membrane major glycoprotein| GP2 precursor (Pancreatic zymogen granule membrane protein GP-2) (ZAP75) Length = 527 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 309 HPSTHRMDCGPFLIGKTRFECVLVGVG-GAEVLKHRRD 199 H ++DCGP I +C+L G+G G EV+ + RD Sbjct: 211 HSLQPQLDCGPREIKVKVDKCLLGGLGLGEEVIAYLRD 248
>HB24_MOUSE (P20040) H-2 class II histocompatibility antigen, E-Q beta chain| precursor (E-W17) Length = 264 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 6/46 (13%) Frame = +1 Query: 184 ETRVRITTVLEDFRA------SDAHEYTFEPGLTNQERAAVHSMCR 303 E +R + + +FRA DA + +P + Q+RAAV + CR Sbjct: 62 EENLRFDSDVGEFRAVTELGRPDAENWNSQPEILEQKRAAVDTYCR 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.127 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,111,261 Number of Sequences: 219361 Number of extensions: 544374 Number of successful extensions: 1240 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)