Clone Name | bastl10f09 |
---|---|
Clone Library Name | barley_pub |
>CLC11_MOUSE (O88200) C-type lectin domain family 11 member A precursor (Stem| cell growth factor) (Lymphocyte secreted C-type lectin) Length = 328 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 104 GRRGMGREWLAGHGGGEKEDRD 39 G RG GREW G GG +E+R+ Sbjct: 21 GARGPGREWEGGWGGALEEERE 42
>Y1039_PYRHO (O58758) Hypothetical ABC transporter extracellular-binding protein| PH1039 precursor Length = 420 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 161 RAPRKAGDESHCPPSRWSRRLVVAFGG-ELLRKATKGSRFGENPQVR 298 +AP +GD P S + ++ FGG +L K KG E+PQVR Sbjct: 197 KAPIVSGDSVGWPLSDVTEHFILTFGGKDLQLKLIKGEVKWEDPQVR 243
>CLC11_HUMAN (Q9Y240) C-type lectin domain family 11 member A precursor (Stem| cell growth factor) (Lymphocyte secreted C-type lectin) (p47) (C-type lectin superfamily member 3) Length = 323 Score = 29.3 bits (64), Expect = 2.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 104 GRRGMGREWLAGHGGGEKEDRD 39 G RG REW G GG ++E+R+ Sbjct: 21 GARGAEREWEGGWGGAQEEERE 42
>RS5_GLOVI (Q7NEG9) 30S ribosomal protein S5| Length = 223 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -1 Query: 122 PRRISVGRRGMGREWLAGHGGGEKEDRDGADVD 24 P R S G R GR AG GGG+K +R A+ + Sbjct: 33 PDRESGGERRRGRGRGAGRGGGDKAERAQAETE 65
>TSP4_RAT (P49744) Thrombospondin-4 precursor| Length = 980 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -3 Query: 282 SPNLEPFVALRSSSPPKATTRRRDQRLGGQCDSSPAFLGAR 160 SP V + +PP TRR CDSSP F G R Sbjct: 286 SPTPNTLVPIAPPAPPTRPTRR--------CDSSPCFRGVR 318
>PCB_PRODI (Q6Q972) Chlorophyll a/b light-harvesting protein pcb| Length = 350 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 194 CPPSRWSRRLVVAFGGELLRKATKG 268 CPP +W++RL++ G LL A G Sbjct: 225 CPPFKWAQRLIIYSGEGLLAYALGG 249
>METK_TREPA (O83772) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) (MAT) Length = 396 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 95 GMGREWLAGHGGGEKEDRDGADVDRSTA 12 GMGR HGGG +D + VDRS A Sbjct: 258 GMGR-----HGGGSFSGKDASKVDRSAA 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,723,489 Number of Sequences: 219361 Number of extensions: 456843 Number of successful extensions: 1593 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1593 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)