Clone Name | bastl10d10 |
---|---|
Clone Library Name | barley_pub |
>PEX6_GLOLA (Q9C1E9) Peroxisomal biogenesis factor 6 (Peroxin-6) (ClaPEX6)| Length = 1388 Score = 30.8 bits (68), Expect = 1.0 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = -3 Query: 181 ALQPWQPSPSTSQRG---VPLLLRARRKPSRGAKSPS 80 A+ PW+PSPS ++ VP+L + KPS SPS Sbjct: 75 AIAPWEPSPSPTETAWTVVPVLKSSALKPSTVQFSPS 111
>B3A2_MOUSE (P13808) Anion exchange protein 2 (Non-erythroid band 3-like| protein) (AE2 anion exchanger) (Solute carrier family 4 member 2) (B3RP) Length = 1237 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -3 Query: 172 PWQPSPSTSQRGVPLLLR----ARRKPSRGAKSPSRQ 74 P QPSP+T+ V L+ A RKP R + SP Q Sbjct: 140 PQQPSPATTPSAVQFFLQEDEGAERKPERTSPSPPTQ 176
>ACVS_NOCLA (P27743) N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase| (EC 6.3.2.26) (Delta-(L-alpha-aminoadipyl)-L-cysteinyl-D-valine synthetase) (ACV synthetase) (ACVS) Length = 3649 Score = 28.5 bits (62), Expect = 5.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 96 PREGFRRARSSRGTPR*EVEGDGCHGWSAQGP 191 P F R++ PR VE CH WSAQ P Sbjct: 2896 PSADFSPKRAAYAAPRDRVEARLCHLWSAQLP 2927
>PRTP_HCMVA (P16724) Probable processing and transport protein UL56 (HFLF0| protein) Length = 850 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -3 Query: 175 QPWQPS--PSTSQRGVPLLLRARRKPSRGAKS 86 +PW PS PS+S GV +RA RK R A S Sbjct: 799 RPWLPSPYPSSSTAGVSRRVRATRKRPRRASS 830
>PLMN_MACMU (P12545) Plasminogen precursor (EC 3.4.21.7) [Contains: Plasmin| heavy chain A; Activation peptide; Plasmin heavy chain A, short form; Plasmin light chain B] Length = 810 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 129 RGTPR*EVEGDGCHGWSAQGP 191 RG V G CHGWSAQ P Sbjct: 284 RGDVAVTVSGHTCHGWSAQTP 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,695,015 Number of Sequences: 219361 Number of extensions: 411799 Number of successful extensions: 1344 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1343 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)