Clone Name | bastl10c04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YD14_SCHPO (Q10237) Hypothetical protein C4G9.04c in chromosome I | 31 | 0.87 | 2 | PCF11_YEAST (P39081) Protein PCF11 (protein 1 of CF I) | 30 | 1.5 | 3 | PCF11_HUMAN (O94913) Pre-mRNA cleavage complex 2 protein Pcf11 (... | 30 | 1.9 | 4 | MASY_GOSHI (P17432) Malate synthase, glyoxysomal (EC 2.3.3.9) | 28 | 5.6 |
---|
>YD14_SCHPO (Q10237) Hypothetical protein C4G9.04c in chromosome I| Length = 638 Score = 30.8 bits (68), Expect = 0.87 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 211 YKEALAELTFNCKPIITELTIIAGQH 288 Y AL +LTFN KPII LT IA ++ Sbjct: 8 YLSALEDLTFNSKPIIHTLTYIAQEN 33
>PCF11_YEAST (P39081) Protein PCF11 (protein 1 of CF I)| Length = 626 Score = 30.0 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 199 VVGVYKEALAELTFNCKPIITELTIIAGQH 288 +V + L ELTFN +PIIT LT +A ++ Sbjct: 8 IVKDFNSILEELTFNSRPIITTLTKLAEEN 37
>PCF11_HUMAN (O94913) Pre-mRNA cleavage complex 2 protein Pcf11 (Pre-mRNA| cleavage complex II protein Pcf11) (Fragment) Length = 1654 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +1 Query: 211 YKEALAELTFNCKPIITELTIIAGQH 288 Y+ +L +LTFN KP I LTI+A ++ Sbjct: 121 YQSSLEDLTFNSKPHINMLTILAEEN 146
>MASY_GOSHI (P17432) Malate synthase, glyoxysomal (EC 2.3.3.9)| Length = 567 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +1 Query: 124 VVGQVVERFRARLREEAGEEPKAAAVVGVYKEALAELTFNC 246 V G+VVE AR+ E G+E G+YKEA T C Sbjct: 501 VFGRVVEEEMARIEREVGKEKFKK---GMYKEACKIFTRQC 538 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,925,179 Number of Sequences: 219361 Number of extensions: 285188 Number of successful extensions: 856 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 856 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)