| Clone Name | bastl10b05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN584_HUMAN (Q8IVC4) Zinc finger protein 584 | 28 | 5.2 | 2 | UBD_HUMAN (O15205) Ubiquitin D (Ubiquitin-like protein FAT10) (D... | 28 | 5.2 | 3 | AGO2_DROME (Q9VUQ5) Argonaute 2 protein | 28 | 8.8 |
|---|
>ZN584_HUMAN (Q8IVC4) Zinc finger protein 584| Length = 421 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 77 DHGGQQRPRRGDRVAPQHG*AVPPGRRCGRHQE 175 D + +PRR +HG A PPG CG+ QE Sbjct: 123 DTHSEGKPRRHT----EHGAAFPPGSSCGQQQE 151
>UBD_HUMAN (O15205) Ubiquitin D (Ubiquitin-like protein FAT10) (Diubiquitin)| Length = 165 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 175 FLVPATSPARRHCLSVLRSDPIAASRPLLPSMVGISRE 62 FLV + A+RH L V RS +A + ++ + GI E Sbjct: 91 FLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPE 128
>AGO2_DROME (Q9VUQ5) Argonaute 2 protein| Length = 1214 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 83 GGQQRPRRGDRVAPQHG*AVPPGRRCGRHQEGR 181 GG Q+ R+G Q PPG++ G HQ+GR Sbjct: 235 GGHQQGRQGQEGGYQQR---PPGQQQGGHQQGR 264 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 83 GGQQRPRRGDRVAPQHG*AVPPGRRCGRHQEGR 181 GG Q+ R+G Q PPG++ G HQ+GR Sbjct: 189 GGHQQGRQGQEGGYQQR---PPGQQQGGHQQGR 218 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 83 GGQQRPRRGDRVAPQHG*AVPPGRRCGRHQEGR 181 GG Q+ R+G Q PPG++ G HQ+GR Sbjct: 143 GGHQQGRQGQEGGYQQR---PPGQQQGGHQQGR 172 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 62 FSRDPDHGGQQRPRRGDRVAPQHG*AVPPGRRCGRHQEGR 181 +++ GG Q+ R+G Q PPG++ G HQ+GR Sbjct: 113 WTKQGQQGGHQQGRQGQDGGYQQR---PPGQQQGGHQQGR 149 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.139 0.567 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,641,969 Number of Sequences: 219361 Number of extensions: 281422 Number of successful extensions: 616 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 616 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)