| Clone Name | bastl09g10 |
|---|---|
| Clone Library Name | barley_pub |
>SIN3B_HUMAN (O75182) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1162 Score = 32.0 bits (71), Expect = 0.46 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 152 TGEGGWIGRGASGSNWDRGG*EAHER 75 +G GG GRG SG+ W R G HE+ Sbjct: 11 SGAGGPAGRGLSGARWGRSGSAGHEK 36
>SIN3B_MOUSE (Q62141) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1098 Score = 31.2 bits (69), Expect = 0.78 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 149 GEGGWIGRGASGSNWDRGG*EAHER 75 G GG GRG GS W R G HE+ Sbjct: 5 GSGGSAGRGFGGSRWGRSGSGGHEK 29
>IF2_THEFY (Q47RV1) Translation initiation factor IF-2| Length = 955 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 12/48 (25%) Frame = -1 Query: 200 PRPNPRES------------GRRRPDWATGEGGWIGRGASGSNWDRGG 93 PRP PR S G RP ++ GG GRG G RGG Sbjct: 243 PRPGPRPSPMNMPASRPTPPGGARPSTSSRSGGGRGRGGGGGAGPRGG 290
>SOX12_HUMAN (O15370) SOX-12 protein (SOX-22 protein)| Length = 315 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 200 PRPNPRESGRRRPDWATGEGGWIGRGASG-SNWDRGG*EAHERRK 69 P P P E G R P W G I R + W + HERRK Sbjct: 18 PGPGPAEEGAREPGWCKTPSGHIKRPMNAFMVWSQ-----HERRK 57
>MCHR1_MACMU (Q8MJ89) Melanin-concentrating hormone receptor 1 (MCH receptor 1)| (MCHR-1) (MCH-R1) (MCH1R) (MCH-1R) (MCHR) (G-protein coupled receptor 24) (Fragment) Length = 388 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = -1 Query: 188 PRESGRR----RPDWATGEGGWIGRGASGSNW 105 P + GRR +P W G W+ A+G+ W Sbjct: 4 PGQGGRRWRLPQPAWVEGSSAWLWEPATGTGW 35
>APS1_SCHPO (Q09790) Diphosphoinositol polyphosphate phosphohydrolase aps1 (EC| 3.6.1.52) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase) (EC 3.6.1.-) (Ap6A hydrolase) Length = 210 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = -1 Query: 179 SGRRRPDWATGEGGW-----IGRGASGSNWDRGG*EAHERR 72 S ++ P W +GGW + + A W+ GG H R Sbjct: 62 SAKKHPSWVVPKGGWEADESVQQAALREGWEEGGLVGHITR 102
>DBP2_YARLI (Q6C4D4) ATP-dependent RNA helicase DBP2 (EC 3.6.1.-)| Length = 552 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 149 GEGGWIGRGASGSNWDRGG 93 G GGW GRG G RGG Sbjct: 502 GRGGWGGRGGRGGRGGRGG 520
>SMG1_DROME (Q70PP2) Serine/threonine-protein kinase Smg1 (EC 2.7.11.1)| Length = 3218 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 155 ATGEGGWIGRGASGSNWDRGG*EAHE 78 ATG G G G S S W GG ++H+ Sbjct: 56 ATGSGNIAGLGGSESMWSPGGGKSHD 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,574,547 Number of Sequences: 219361 Number of extensions: 413252 Number of successful extensions: 1395 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1394 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)