| Clone Name | bastl09g05 |
|---|---|
| Clone Library Name | barley_pub |
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 39.3 bits (90), Expect = 0.002 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = +2 Query: 128 LFRTKLVSEIREVEAATRREISAKEEELRQLVGRSYR 238 LF T EIR +E R EI K+EELRQ+VG YR Sbjct: 21 LFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYR 57
>COG1_HUMAN (Q8WTW3) Conserved oligomeric Golgi complex component 1| Length = 980 Score = 39.3 bits (90), Expect = 0.002 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = +2 Query: 128 LFRTKLVSEIREVEAATRREISAKEEELRQLVGRSYR 238 LF T EIR +E R EI K+EELRQ+VG YR Sbjct: 21 LFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYR 57
>COG1_DROME (Q9VGC3) Putative conserved oligomeric Golgi complex component 1| Length = 886 Score = 30.8 bits (68), Expect = 0.83 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +2 Query: 122 EELFRTKLVSEIREVEAATRREISAKEEELRQLVGRSYR 238 + LF VSEI EV + + K EELR VG YR Sbjct: 11 DTLFEQHSVSEIDEVHKKIQSVVENKREELRTHVGERYR 49
>APOE_PIG (P18650) Apolipoprotein E precursor (Apo-E)| Length = 317 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 122 EELFRTKLVSEIREVEAATRREISAKEEELRQLVG 226 EEL TK+ E+ E+ + +E+ A EEL +G Sbjct: 66 EELLSTKVTQELTELIEESMKEVKAYREELEAQLG 100
>APOE_BOVIN (Q03247) Apolipoprotein E precursor (Apo-E)| Length = 316 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 122 EELFRTKLVSEIREVEAATRREISAKEEELRQLVG 226 EEL T+++ E+ + T +E+ A +EEL +G Sbjct: 66 EELLNTQVIQELTALMEETMKEVKAYKEELEGQLG 100
>SYFA_LACAC (Q5FIY6) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase alpha chain) (PheRS) Length = 349 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 137 TKLVSEIREVEAATRREISAKEEELRQL 220 TK++ +R+V RRE+ K ELR L Sbjct: 42 TKILHSMRDVAPENRREVGQKVNELRDL 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,721,650 Number of Sequences: 219361 Number of extensions: 64559 Number of successful extensions: 366 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)