Clone Name | bastl09g04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NKX31_MOUSE (P97436) Homeobox protein Nkx-3.1 | 28 | 4.3 | 2 | RLUD_PASMU (Q9CKA6) Ribosomal large subunit pseudouridine syntha... | 27 | 9.5 | 3 | Y7973_BRAJA (Q89C25) UPF0313 protein blr7973 | 27 | 9.5 | 4 | TATB_SHEON (Q8E9R3) Sec-independent protein translocase protein ... | 27 | 9.5 | 5 | PAIP1_XENLA (Q7ZYB4) Polyadenylate-binding protein-interacting p... | 27 | 9.5 |
---|
>NKX31_MOUSE (P97436) Homeobox protein Nkx-3.1| Length = 237 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 62 NPAHSSAPQSISTPTRSIGGTFCSKSRGIAPESPTAETHT 181 NP HS P+ S P G RG+APE P + H+ Sbjct: 52 NPQHSPDPRRDSAPEPDKAG-----GRGVAPEDPPSIRHS 86
>RLUD_PASMU (Q9CKA6) Ribosomal large subunit pseudouridine synthase D (EC| 5.4.99.-) (rRNA-uridine isomerase D) (rRNA pseudouridylate synthase D) Length = 324 Score = 27.3 bits (59), Expect = 9.5 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 7/46 (15%) Frame = -3 Query: 353 KIGVASKRDRVPSGC-------PRQSKGSRRDQRRKITREPSLVAC 237 + G+ + D+ +G P Q+K R Q+RKITRE +AC Sbjct: 130 RAGIVHRLDKDTTGLMVIAKTIPAQTKLVRDLQKRKITREYEAIAC 175
>Y7973_BRAJA (Q89C25) UPF0313 protein blr7973| Length = 673 Score = 27.3 bits (59), Expect = 9.5 Identities = 25/86 (29%), Positives = 34/86 (39%) Frame = -2 Query: 345 SSQQKGSRPFRMPAPVQGQQTRSAEKDHTRTEPRSMRP*AXXXXXXXXXXXXGTRVWVSA 166 +++QKG+ R+PA Q +Q + A +R R P R V Sbjct: 243 ATRQKGATVIRLPALEQVEQDKEAYARASRVLHRESNP-------------GNARPLVQR 289 Query: 165 VGDSGAMPRDLEQKVPPIDLVGVDMD 88 GD RDL PPI L +MD Sbjct: 290 HGD-----RDLWLNPPPIPLTSDEMD 310
>TATB_SHEON (Q8E9R3) Sec-independent protein translocase protein tatB homolog| Length = 149 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +2 Query: 62 NPAHSSAPQSISTPTRSIGGTFCSKSRGIAPESPTAET 175 N H+ A Q++ST S + KS I E P + T Sbjct: 108 NQIHNPASQTVSTEASSTSASSAPKSESIQGEDPRSNT 145
>PAIP1_XENLA (Q7ZYB4) Polyadenylate-binding protein-interacting protein 1| (Poly(A)-binding protein-interacting protein 1) (PABP-interacting protein 1) (PAIP-1) (Paip1 protein) (XlPaip1) Length = 463 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -2 Query: 345 SSQQKGSRPFRMPAPVQGQQTRSAEKDHTRTEPRSMRP 232 S QQ+ RP R P G +A+ H RT P + P Sbjct: 50 SQQQEPLRPPRTGPPGGGGDAGAAQTSHKRTSPAAQLP 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,248,554 Number of Sequences: 219361 Number of extensions: 504164 Number of successful extensions: 1502 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1502 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)