| Clone Name | bastl09f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2) | 54 | 1e-07 | 2 | NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3) | 54 | 1e-07 | 3 | NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5) | 54 | 1e-07 | 4 | TNR17_MOUSE (O88472) Tumor necrosis factor receptor superfamily ... | 28 | 4.4 | 5 | Y165_AQUAE (O66552) Hypothetical UPF0088 protein aq_165 | 27 | 9.9 |
|---|
>NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2)| Length = 1267 Score = 53.9 bits (128), Expect = 1e-07 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = +3 Query: 108 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYFIPV 284 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY+ IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82 Query: 285 YXQGSFVVRVK 317 Y +G F+++++ Sbjct: 83 YDKGDFILKIE 93
>NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3)| Length = 1222 Score = 53.9 bits (128), Expect = 1e-07 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = +3 Query: 108 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYFIPV 284 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY+ IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82 Query: 285 YXQGSFVVRVK 317 Y +G F+++++ Sbjct: 83 YDKGDFILKIE 93
>NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5)| Length = 1222 Score = 53.9 bits (128), Expect = 1e-07 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = +3 Query: 108 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYFIPV 284 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY+ IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82 Query: 285 YXQGSFVVRVK 317 Y +G F+++++ Sbjct: 83 YDKGDFILKIE 93
>TNR17_MOUSE (O88472) Tumor necrosis factor receptor superfamily member 17| (B-cell maturation protein) Length = 185 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/67 (23%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = +3 Query: 111 EIDGCGGFVEASSGLAKSRRASESKFDYS-DITVELCTVDGLVKESTQCAPNGYYFIPVY 287 ++DG +A + L + R + F S + TVE CT + VK + + ++ +P Sbjct: 89 QLDGSAQLDKADTELTRIRAGDDRIFPRSLEYTVEECTCEDCVKSKPKGDSDHFFPLPAM 148 Query: 288 XQGSFVV 308 +G+ ++ Sbjct: 149 EEGATIL 155
>Y165_AQUAE (O66552) Hypothetical UPF0088 protein aq_165| Length = 229 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +3 Query: 192 YSDITVELCTVDGLVKESTQCAPNGYYFIPVYXQGSF 302 Y +TV+L T+D +V+++T+ F+P+ + SF Sbjct: 76 YQSVTVDLKTMDTIVRQATELGV--LTFVPIISERSF 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,133,457 Number of Sequences: 219361 Number of extensions: 429679 Number of successful extensions: 844 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)