Clone Name | bastl09f05 |
---|---|
Clone Library Name | barley_pub |
>CARB_SYNY3 (Q55756) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + KIMILGAGPIVIGQACEF Sbjct: 7 LNKIMILGAGPIVIGQACEF 26
>CARB_SHIFL (P63738) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25
>CARB_PSEAE (P38100) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KIMILG GP IGQ EF Sbjct: 558 EKIMILGGGPNRIGQGIEF 576
>CARB_ECOLI (P00968) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25
>CARB_ECOL6 (Q8FLB0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25
>CARB_ECO57 (P63737) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25
>CARB_BUCAI (P57244) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1078 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KKI+ILG GP IGQ EF Sbjct: 559 KKIIILGGGPNRIGQGIEF 577
>CARB_PSESM (Q87WP4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1073 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 7 IKSILILGAGPIVIGQACEF 26
>CARB_PSEPK (Q88DU6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1073 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 7 IKSILILGAGPIVIGQACEF 26
>CARB_YERPE (Q8ZIL4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25
>CARB_BUCAP (Q8K9Z7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25
>CARB_SALTY (P14846) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1074 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25
>CARB_SALTI (Q8Z9L7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1074 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPIVIGQACEF Sbjct: 6 IKSILILGAGPIVIGQACEF 25
>CARB_BUCBP (P59448) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 39.7 bits (91), Expect = 0.003 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+ILGAGPI+IGQACEF Sbjct: 7 IKSILILGAGPIIIGQACEF 26 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KKI+ILG GP IGQ EF Sbjct: 560 KKIIILGGGPNRIGQGIEF 578
>CARB_BRUSU (Q8FZJ3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 IKSILIIGAGPIVIGQACEF 26 Score = 32.3 bits (72), Expect = 0.46 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 324 FAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 F +P +++ KK++ILG GP IGQ EF Sbjct: 605 FVGQPRSEAEVSDRKKVVILGGGPNRIGQGIEF 637
>CARB_BRUME (Q8YIC2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 IKSILIIGAGPIVIGQACEF 26 Score = 32.3 bits (72), Expect = 0.46 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 324 FAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 F +P +++ KK++ILG GP IGQ EF Sbjct: 605 FVGQPRSEAEVSDRKKVVILGGGPNRIGQGIEF 637
>CARB_AGRT5 (Q8UDE9) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1162 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 IKSILIIGAGPIVIGQACEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 324 FAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 F Q++ KK++ILG GP IGQ EF Sbjct: 606 FVGAARSEAQVSDRKKVVILGGGPNRIGQGIEF 638
>CARB_RHOBA (Q7UJ58) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1083 Score = 39.3 bits (90), Expect = 0.004 Identities = 15/20 (75%), Positives = 20/20 (100%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KKI+++G+GPIVIGQACEF Sbjct: 7 IKKILLIGSGPIVIGQACEF 26
>CARB_RHILO (Q98I87) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1167 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 IKSILIIGAGPIVIGQACEF 26 Score = 30.8 bits (68), Expect = 1.4 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 324 FAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 FA Q++ KK++ILG GP IGQ EF Sbjct: 611 FAGALANEAQVSSRKKVVILGGGPNRIGQGIEF 643
>CARB_RHIME (Q92PZ4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1163 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 IKSILIIGAGPIVIGQACEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 324 FAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 F Q++ KK++ILG GP IGQ EF Sbjct: 606 FVGAARSEAQVSDRKKVVILGGGPNRIGQGIEF 638
>CARB_NEIMB (Q9JXW8) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1071 Score = 38.5 bits (88), Expect = 0.006 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 LKSILIIGAGPIVIGQACEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK+MILG GP IGQ EF Sbjct: 554 KKVMILGGGPNRIGQGIEF 572
>CARB_NEIMA (Q9JW02) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1071 Score = 38.5 bits (88), Expect = 0.006 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 LKSILIIGAGPIVIGQACEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK+MILG GP IGQ EF Sbjct: 554 KKVMILGGGPNRIGQGIEF 572
>CARB_NEIGO (Q59599) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1071 Score = 38.5 bits (88), Expect = 0.006 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 LKSILIIGAGPIVIGQACEF 26 Score = 31.2 bits (69), Expect = 1.0 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK+MILGAGP IGQ EF Sbjct: 554 KKVMILGAGPNPIGQGIEF 572
>CARB_ANASP (Q8YQL2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1104 Score = 38.5 bits (88), Expect = 0.006 Identities = 15/20 (75%), Positives = 20/20 (100%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KI++LG+GPIVIGQACEF Sbjct: 7 IQKILLLGSGPIVIGQACEF 26
>CARB_VIBCH (Q9KPH9) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 38.5 bits (88), Expect = 0.006 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+ILGAGPIVIGQACEF Sbjct: 7 IQSILILGAGPIVIGQACEF 26
>CARB_VIBVY (Q7MNU0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1077 Score = 38.5 bits (88), Expect = 0.006 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+ILGAGPIVIGQACEF Sbjct: 7 IQSILILGAGPIVIGQACEF 26
>CARB_VIBVU (Q8DEM2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1077 Score = 38.5 bits (88), Expect = 0.006 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+ILGAGPIVIGQACEF Sbjct: 7 IQSILILGAGPIVIGQACEF 26
>CARB_VIBPA (Q87SF3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1077 Score = 38.5 bits (88), Expect = 0.006 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+ILGAGPIVIGQACEF Sbjct: 7 IQSILILGAGPIVIGQACEF 26
>CARB_RALSO (Q8XZ83) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1081 Score = 38.5 bits (88), Expect = 0.006 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPI+IGQACEF Sbjct: 7 IKTILIIGAGPIIIGQACEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KKIM+LG GP IGQ EF Sbjct: 564 KKIMVLGGGPNRIGQGIEF 582
>CARB_ZYMMO (O50236) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1112 Score = 38.1 bits (87), Expect = 0.008 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ IMI+GAGPIVIGQACEF Sbjct: 7 LQSIMIIGAGPIVIGQACEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 324 FAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 F EP + KK++ILG GP IGQ EF Sbjct: 579 FFGEPVCDSLPSNRKKVVILGGGPNRIGQGLEF 611
>CARB_XANCP (P58943) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 38.1 bits (87), Expect = 0.008 Identities = 16/20 (80%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+I+GAGPIVIGQACEF Sbjct: 7 LKTILIIGAGPIVIGQACEF 26
>CARB_HALER (Q8RSS3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 37.7 bits (86), Expect = 0.011 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+I+GAGPIVIGQACEF Sbjct: 7 IQSILIIGAGPIVIGQACEF 26
>CARB_LEPIN (Q8F832) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1106 Score = 37.4 bits (85), Expect = 0.014 Identities = 14/20 (70%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ ++ILG+GPIVIGQACEF Sbjct: 7 IRSVLILGSGPIVIGQACEF 26
>CARB_LEPIC (Q72NF1) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1106 Score = 37.4 bits (85), Expect = 0.014 Identities = 14/20 (70%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ ++ILG+GPIVIGQACEF Sbjct: 7 IRSVLILGSGPIVIGQACEF 26
>CARB_LACLC (O32771) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1064 Score = 37.4 bits (85), Expect = 0.014 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KKIMI+G+GPI+IGQA EF Sbjct: 7 IKKIMIIGSGPIIIGQAAEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKIIVLGSGPIRIGQGVEF 570
>CARB_LACLA (Q9CFV2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1064 Score = 37.4 bits (85), Expect = 0.014 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KKIMI+G+GPI+IGQA EF Sbjct: 7 IKKIMIIGSGPIIIGQAAEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKIIVLGSGPIRIGQGVEF 570
>CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 37.4 bits (85), Expect = 0.014 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + I+I+GAGPIVIGQACEF Sbjct: 7 ISSILIIGAGPIVIGQACEF 26
>CARB_CAMJE (Q9PIL7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1089 Score = 37.4 bits (85), Expect = 0.014 Identities = 14/20 (70%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPIVIGQACEF Sbjct: 7 IKSILLIGSGPIVIGQACEF 26 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK+MI+G GP IGQ EF Sbjct: 561 KKVMIIGGGPNRIGQGIEF 579
>CARB_BACHD (Q9K9V9) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1062 Score = 37.4 bits (85), Expect = 0.014 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +3 Query: 348 GQLAGVKKIMILGAGPIVIGQACEF 422 G+ +KKI+++G+GPIVIGQA EF Sbjct: 2 GKREDIKKILVIGSGPIVIGQAAEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 K I++LG+GPI IGQ EF Sbjct: 552 KSILVLGSGPIRIGQGIEF 570
>CARB_XYLFT (Q87EB8) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 37.0 bits (84), Expect = 0.019 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+I+GAGPIVIGQACEF Sbjct: 7 LRTILIIGAGPIVIGQACEF 26 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KIMILG GP IGQ EF Sbjct: 560 RKIMILGGGPNRIGQGIEF 578
>CARB_XYLFA (Q9PEC1) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 37.0 bits (84), Expect = 0.019 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+I+GAGPIVIGQACEF Sbjct: 7 LRTILIIGAGPIVIGQACEF 26 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KIMILG GP IGQ EF Sbjct: 560 RKIMILGGGPNRIGQGIEF 578
>CARB_PASMU (Q9CKV0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1068 Score = 37.0 bits (84), Expect = 0.019 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + I+I+GAGPIVIGQACEF Sbjct: 7 INTILIIGAGPIVIGQACEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KKIMILG GP IGQ EF Sbjct: 554 KKIMILGGGPNRIGQGIEF 572
>CARB1_METJA (Q58773) Carbamoyl-phosphate synthase large chain, N-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 482 Score = 36.6 bits (83), Expect = 0.025 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = +3 Query: 354 LAGVKKIMILGAGPIVIGQACEF 422 + +KK+M+ G+GPIVIGQA EF Sbjct: 1 MESIKKVMVFGSGPIVIGQAAEF 23
>CARB1_AQUAE (O67869) Carbamoyl-phosphate synthase large chain, N-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 557 Score = 36.6 bits (83), Expect = 0.025 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KKI+I+G+GPIVIGQA EF Sbjct: 7 IKKILIIGSGPIVIGQAAEF 26
>CARB_HAEDU (Q7VP67) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1075 Score = 36.6 bits (83), Expect = 0.025 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + I+I+GAGPI+IGQACEF Sbjct: 7 INTILIIGAGPIIIGQACEF 26
>CARB_XANAC (P58942) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 36.6 bits (83), Expect = 0.025 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+I+GAGPIVIGQACEF Sbjct: 7 LETILIIGAGPIVIGQACEF 26
>CARB_STRA5 (Q8DZQ7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1060 Score = 36.2 bits (82), Expect = 0.032 Identities = 14/20 (70%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPIVIGQA EF Sbjct: 7 IRKIMVIGSGPIVIGQAAEF 26
>CARB_STRA3 (Q8E5F5) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1060 Score = 36.2 bits (82), Expect = 0.032 Identities = 14/20 (70%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPIVIGQA EF Sbjct: 7 IRKIMVIGSGPIVIGQAAEF 26
>CARB_ARCFU (O28994) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1076 Score = 36.2 bits (82), Expect = 0.032 Identities = 14/20 (70%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPIVIGQA EF Sbjct: 7 IRKIMVIGSGPIVIGQAAEF 26 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK+MILGAGP IGQ EF Sbjct: 561 KKVMILGAGPNRIGQGIEF 579
>CARB_HELPY (O25577) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1085 Score = 35.4 bits (80), Expect = 0.055 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + I+++G+GPIVIGQACEF Sbjct: 7 ISNILLIGSGPIVIGQACEF 26 Score = 28.9 bits (63), Expect = 5.1 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 336 PTKGGQLAGVKKIMILGAGPIVIGQACEF 422 P + Q KKI+I+G+GP IGQ EF Sbjct: 549 PIENKQEKKEKKILIIGSGPNRIGQGIEF 577
>CARB_HELPJ (Q9ZKT2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1085 Score = 35.4 bits (80), Expect = 0.055 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + I+++G+GPIVIGQACEF Sbjct: 7 ISNILLIGSGPIVIGQACEF 26 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KKI+I+G+GP IGQ EF Sbjct: 559 KKILIIGSGPNRIGQGIEF 577
>CARB_CLOPE (Q8XHB3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1067 Score = 35.4 bits (80), Expect = 0.055 Identities = 12/20 (60%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KK++++G+GPI+IGQA EF Sbjct: 7 IKKVLVIGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK++++G+GPI IGQ EF Sbjct: 555 KKVVVIGSGPIRIGQGIEF 573
>CARB_STRR6 (Q8CWR0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 35.4 bits (80), Expect = 0.055 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPI+IGQA EF Sbjct: 7 IQKIMVIGSGPIIIGQAAEF 26
>CARB_STRPN (Q97QE4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 35.4 bits (80), Expect = 0.055 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPI+IGQA EF Sbjct: 7 IQKIMVIGSGPIIIGQAAEF 26
>CARB_STRP8 (P58941) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 35.4 bits (80), Expect = 0.055 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPI+IGQA EF Sbjct: 7 IQKIMVIGSGPIIIGQAAEF 26
>CARB_STRP6 (Q5XCR6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 35.4 bits (80), Expect = 0.055 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPI+IGQA EF Sbjct: 7 IQKIMVIGSGPIIIGQAAEF 26
>CARB_STRP3 (Q8K7Y3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 35.4 bits (80), Expect = 0.055 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPI+IGQA EF Sbjct: 7 IQKIMVIGSGPIIIGQAAEF 26
>CARB_STRP1 (Q9A0C6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 35.4 bits (80), Expect = 0.055 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++KIM++G+GPI+IGQA EF Sbjct: 7 IQKIMVIGSGPIIIGQAAEF 26
>CARB_CORGL (P58939) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1113 Score = 35.0 bits (79), Expect = 0.072 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + ++++G+GPIVIGQACEF Sbjct: 7 INHVLVIGSGPIVIGQACEF 26 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = +3 Query: 291 AAQDIAVTVRHFAA---EPTKGGQLAGV---KKIMILGAGPIVIGQACEF 422 AA+ A T H++A +P ++A +K++ILG+GP IGQ EF Sbjct: 541 AAEFEAKTPYHYSAYELDPAAESEVAPQTEREKVLILGSGPNRIGQGIEF 590
>CARB_LACPL (P77886) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 34.7 bits (78), Expect = 0.094 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + KIM++G+GPI+IGQA EF Sbjct: 7 IHKIMVIGSGPIIIGQAAEF 26
>CARB_MYCTU (P57689) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1115 Score = 34.3 bits (77), Expect = 0.12 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +3 Query: 372 IMILGAGPIVIGQACEF 422 ++++G+GPIVIGQACEF Sbjct: 10 VLVIGSGPIVIGQACEF 26
>CARB_MYCBO (Q7U054) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1115 Score = 34.3 bits (77), Expect = 0.12 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +3 Query: 372 IMILGAGPIVIGQACEF 422 ++++G+GPIVIGQACEF Sbjct: 10 VLVIGSGPIVIGQACEF 26
>CARB_THET2 (P96495) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1028 Score = 34.3 bits (77), Expect = 0.12 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KKI+I+G+GPI IGQA EF Sbjct: 7 LKKILIIGSGPITIGQAAEF 26 Score = 28.9 bits (63), Expect = 5.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 369 KIMILGAGPIVIGQACEF 422 K++ILG+GPI IGQ EF Sbjct: 556 KVVILGSGPIRIGQGVEF 573
>CARB_MYCLE (Q9CCR2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1121 Score = 34.3 bits (77), Expect = 0.12 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = +3 Query: 372 IMILGAGPIVIGQACEF 422 ++++G+GPIVIGQACEF Sbjct: 10 VLVIGSGPIVIGQACEF 26
>CARB_METAC (Q8TNY4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 33.9 bits (76), Expect = 0.16 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KK++++G+GPI IGQA EF Sbjct: 7 IKKVLLIGSGPITIGQAAEF 26 Score = 32.7 bits (73), Expect = 0.36 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KKI+ILGAGPI IGQ EF Sbjct: 546 KKILILGAGPIRIGQGIEF 564
>CARB_LISMO (Q8Y665) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 33.9 bits (76), Expect = 0.16 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPIVIGQA EF Sbjct: 7 IKTILVIGSGPIVIGQAAEF 26
>CARB_LISMF (Q71YI1) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 33.9 bits (76), Expect = 0.16 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPIVIGQA EF Sbjct: 7 IKTILVIGSGPIVIGQAAEF 26
>CARB_LISIN (Q92AH3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1070 Score = 33.9 bits (76), Expect = 0.16 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPIVIGQA EF Sbjct: 7 IKTILVIGSGPIVIGQAAEF 26
>CARB_METMA (P58944) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1073 Score = 33.9 bits (76), Expect = 0.16 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KK++++G+GPI IGQA EF Sbjct: 7 IKKVLLIGSGPITIGQAAEF 26 Score = 32.7 bits (73), Expect = 0.36 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KKI+ILGAGPI IGQ EF Sbjct: 546 KKILILGAGPIRIGQGIEF 564
>CARB_THEVO (Q97AJ3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1044 Score = 33.9 bits (76), Expect = 0.16 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + KI+++G+GP+VIGQA EF Sbjct: 7 ISKILVIGSGPVVIGQAAEF 26
>CARB_BACSU (P25994) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1071 Score = 33.9 bits (76), Expect = 0.16 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + KI+++G+GPI+IGQA EF Sbjct: 7 INKILVIGSGPIIIGQAAEF 26 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 K +M+LG+GPI IGQ EF Sbjct: 552 KSVMVLGSGPIRIGQGVEF 570
>CARB_THETN (Q8RBK0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1072 Score = 33.5 bits (75), Expect = 0.21 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + K++++G+GPI+IGQA EF Sbjct: 7 ISKVLVIGSGPIIIGQAAEF 26 Score = 28.5 bits (62), Expect = 6.7 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + K++++G+GPI IGQ EF Sbjct: 551 IPKVIVIGSGPIRIGQGIEF 570
>CARB_STAAW (P58940) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 33.5 bits (75), Expect = 0.21 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPI+IGQA EF Sbjct: 7 IKTILVIGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>CARB_STAAS (Q6GA10) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 33.5 bits (75), Expect = 0.21 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPI+IGQA EF Sbjct: 7 IKTILVIGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>CARB_STAAR (Q6GHN2) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 33.5 bits (75), Expect = 0.21 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPI+IGQA EF Sbjct: 7 IKTILVIGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>CARB_STAAN (P63740) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 33.5 bits (75), Expect = 0.21 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPI+IGQA EF Sbjct: 7 IKTILVIGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>CARB_STAAM (P63739) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 33.5 bits (75), Expect = 0.21 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPI+IGQA EF Sbjct: 7 IKTILVIGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>CARB_STAAC (Q5HGM9) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 33.5 bits (75), Expect = 0.21 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPI+IGQA EF Sbjct: 7 IKTILVIGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>CARB_THEMA (Q9WZ27) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 33.5 bits (75), Expect = 0.21 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K+I+++G+GPI IGQA EF Sbjct: 7 IKRILVIGSGPITIGQAAEF 26 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KIMILG+GP IGQ EF Sbjct: 547 EKIMILGSGPNRIGQGIEF 565
>CARB_FUSNN (Q8RG86) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1058 Score = 33.5 bits (75), Expect = 0.21 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPI+IGQA EF Sbjct: 7 IKTILVIGSGPIIIGQAAEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKIVVLGSGPIRIGQGIEF 570
>CARB_STAES (Q8CPJ4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 33.1 bits (74), Expect = 0.27 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +K I+++G+GPI+IGQA EF Sbjct: 7 IKTILVVGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>SH2D3_MOUSE (Q9QZS8) SH2 domain-containing protein 3C (SH2 domain-containing| Eph receptor-binding protein 1) (Cas/HEF1-associated signal transducer) Length = 854 Score = 33.1 bits (74), Expect = 0.27 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 5 LHAPLIPLQKNPTSPSPPSTLHFAAASSTPPTLCAP 112 LH+PL P+ ++P+SP+ + A S+TP T P Sbjct: 398 LHSPLSPISESPSSPAYSTVTRVHAPSATPSTSAQP 433
>PYR1_EMENI (O93937) Protein pyrABCN [Includes: Glutamine-dependent| carbamoyl-phosphate (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2275 Score = 32.7 bits (73), Expect = 0.36 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 330 AEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 AE K VKK++ILG+G + IGQA EF Sbjct: 469 AENIKASPRVSVKKVLILGSGGLSIGQAGEF 499
>CARY_BACST (Q9ZB63) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1043 Score = 32.7 bits (73), Expect = 0.36 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +3 Query: 351 QLAGVKKIMILGAGPIVIGQACEF 422 Q +G +K++I+GAGPI IGQ EF Sbjct: 552 QPSGKEKVLIIGAGPIRIGQGIEF 575
>PYR1_HUMAN (P27708) CAD protein [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2225 Score = 32.3 bits (72), Expect = 0.46 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 336 PTKGGQLAGVKKIMILGAGPIVIGQACEF 422 PT G L +K++ILG+G + IGQA EF Sbjct: 384 PTPGSGLPPPRKVLILGSGGLSIGQAGEF 412
>CARB_BACST (O50302) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1064 Score = 32.3 bits (72), Expect = 0.46 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+++G+GPIVIGQA EF Sbjct: 7 IETILVIGSGPIVIGQAAEF 26
>CARY_BACHD (Q9K8V7) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1047 Score = 32.3 bits (72), Expect = 0.46 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ ++++G+GPIVIGQA EF Sbjct: 7 IQSVLVIGSGPIVIGQAAEF 26
>CARB_THEAC (Q9HK17) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1047 Score = 32.3 bits (72), Expect = 0.46 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + +I+++G+GP+VIGQA EF Sbjct: 7 IHRILVIGSGPVVIGQAAEF 26
>CARB_STRCO (Q9KXR6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1102 Score = 32.3 bits (72), Expect = 0.46 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ ++++G+GPIVIGQA EF Sbjct: 7 IQSVLVIGSGPIVIGQAAEF 26
>CARB_STRAW (Q827Q7) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1102 Score = 32.3 bits (72), Expect = 0.46 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ ++++G+GPIVIGQA EF Sbjct: 7 IQSVLVIGSGPIVIGQAAEF 26
>CARB_BACCL (P46537) Carbamoyl-phosphate synthase pyrimidine-specific large| chain (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1065 Score = 32.3 bits (72), Expect = 0.46 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+++G+GPIVIGQA EF Sbjct: 7 IETILVIGSGPIVIGQAAEF 26
>CARB1_METKA (Q8TWX0) Carbamoyl-phosphate synthase large chain, N-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 564 Score = 32.3 bits (72), Expect = 0.46 Identities = 11/18 (61%), Positives = 17/18 (94%) Frame = +3 Query: 369 KIMILGAGPIVIGQACEF 422 K++I+G+GPI++GQA EF Sbjct: 7 KVLIIGSGPIIVGQAAEF 24
>CARY_BACSU (P18185) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1030 Score = 32.0 bits (71), Expect = 0.61 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + I+++G+GPI+IGQA EF Sbjct: 7 ISSILVIGSGPIIIGQAAEF 26
>CARB_STAS1 (Q49WY4) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 32.0 bits (71), Expect = 0.61 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+++G+GPI+IGQA EF Sbjct: 7 IETILVIGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>CARB_STAHJ (Q4L5Q5) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 32.0 bits (71), Expect = 0.61 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+++G+GPI+IGQA EF Sbjct: 7 IQTILVIGSGPIIIGQAAEF 26 Score = 30.0 bits (66), Expect = 2.3 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 291 AAQDIAVTVRHFAAEPTKGGQLAGVK-KIMILGAGPIVIGQACEF 422 AA+ + T ++ T+ + K KI++LG+GPI IGQ EF Sbjct: 526 AAEFESTTPYYYGTYETENESIVTDKEKILVLGSGPIRIGQGVEF 570
>CARB_METTH (O27077) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1060 Score = 32.0 bits (71), Expect = 0.61 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + K++I+G+GPI IGQA EF Sbjct: 7 INKVLIIGSGPIQIGQAAEF 26 Score = 29.3 bits (64), Expect = 3.9 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +K++I+G+GPI IGQ EF Sbjct: 545 RKVLIIGSGPIRIGQGIEF 563
>CARB_STAEQ (Q5HPY8) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1057 Score = 31.6 bits (70), Expect = 0.79 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+++G+GPI+IGQA EF Sbjct: 7 IQTILVVGSGPIIIGQAAEF 26 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 +KI++LG+GPI IGQ EF Sbjct: 552 EKILVLGSGPIRIGQGVEF 570
>PCD15_MOUSE (Q99PJ1) Protocadherin-15 precursor| Length = 1943 Score = 30.8 bits (68), Expect = 1.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 23 PLQKNPTSPSPPSTLHFAAASSTPPTLCAP 112 PL +P +P PP + F+ STPPT P Sbjct: 1767 PLPLSPPNPPPPQLVTFSLPISTPPTSSLP 1796
>CARB_CLOAB (Q97FT3) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1065 Score = 30.8 bits (68), Expect = 1.4 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 +KK++I+G+GP IGQA EF Sbjct: 7 IKKVLIIGSGPNNIGQAAEF 26 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KKI+++G+GPI IGQ EF Sbjct: 554 KKIVVIGSGPIRIGQGIEF 572
>CARB_DEIRA (Q9RWK0) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1024 Score = 30.4 bits (67), Expect = 1.8 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 ++ I+ILG+GPI IGQA EF Sbjct: 7 LQTILILGSGPIQIGQAAEF 26
>MLL4_HUMAN (Q9UMN6) Myeloid/lymphoid or mixed-lineage leukemia protein 4| (Trithorax homolog 2) Length = 2715 Score = 30.4 bits (67), Expect = 1.8 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +2 Query: 11 APLIPLQKNPTSPSPPSTLHFAAASSTPPTLCAPP 115 A L P P +PSPP L ++S PP LC PP Sbjct: 399 AKLPPPPLTPPAPSPPPPLP-PPSTSPPPPLCPPP 432
>CPSM_HUMAN (P31327) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 30.0 bits (66), Expect = 2.3 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 306 AVTVRHFAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 A T+ +P V K++ILG+G + IGQA EF Sbjct: 403 ATTITSVLPKPALVASRVEVSKVLILGSGGLSIGQAGEF 441
>CARB2_METJA (Q58776) Carbamoyl-phosphate synthase large chain, C-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 618 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK++I+G+GPI IGQ EF Sbjct: 85 KKVIIIGSGPIRIGQGIEF 103
>CARB_YEAST (P03965) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase, ammonia chain) Length = 1118 Score = 29.6 bits (65), Expect = 3.0 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 324 FAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 F E K + GV ++++G+G + IGQA EF Sbjct: 15 FTTEDYKPQLVEGVNSVLVIGSGGLSIGQAGEF 47
>PYR1_DICDI (P20054) Protein PYR1-3 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2185 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 360 GVKKIMILGAGPIVIGQACEF 422 G+ K++ILG+G + IGQA EF Sbjct: 364 GINKVLILGSGGLSIGQAGEF 384
>MADCA_HUMAN (Q13477) Mucosal addressin cell adhesion molecule 1 precursor| (MAdCAM-1) (hMAdCAM-1) Length = 406 Score = 28.9 bits (63), Expect = 5.1 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 8 HAPLIPLQKNPTSPSPPSTLHFAAASSTPPTLCAP 112 H IP+ +PTSP PP T S PP +P Sbjct: 217 HRQAIPVLHSPTSPEPPDT-----TSPEPPNTTSP 246
>CARB_SULSO (Q59969) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1051 Score = 28.9 bits (63), Expect = 5.1 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK++++G+GPI I +A EF Sbjct: 6 KKVLVIGSGPIKIAEAAEF 24
>PXK_MOUSE (Q8BX57) PX domain-containing protein kinase-like protein| (Modulator of Na,K-ATPase) (MONaKA) Length = 582 Score = 28.9 bits (63), Expect = 5.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 35 NPTSPSPPSTLHFAAASSTPPTLCAPP 115 +P+SP+PPST ++A PP PP Sbjct: 499 SPSSPTPPSTAGLSSALPPPPPPPPPP 525
>SH2D3_HUMAN (Q8N5H7) SH2 domain-containing protein 3C (Novel SH2-containing| protein 3) Length = 860 Score = 28.9 bits (63), Expect = 5.1 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 5 LHAPLIPLQKNPTSPSPPSTLHFAAASSTPPTLCAP 112 LH+P+ P+ ++P+SP+ + AA + P P Sbjct: 403 LHSPMSPISESPSSPAYSTVTRVHAAPAAPSATALP 438
>CARB_HALSA (Q9HP43) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1042 Score = 28.9 bits (63), Expect = 5.1 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 + I+++G+GPI IGQA EF Sbjct: 6 RTILLIGSGPIQIGQAAEF 24
>PXK_RAT (Q4FZZ1) PX domain-containing protein kinase-like protein| (Modulator of Na,K-ATPase) (MONaKA) Length = 580 Score = 28.9 bits (63), Expect = 5.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 35 NPTSPSPPSTLHFAAASSTPPTLCAPP 115 +P+SP+PPST ++A PP PP Sbjct: 499 SPSSPTPPSTAGLSSALPPPPPPPPPP 525
>CPSM_RAT (P07756) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 312 TVRHFAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 T+ +P V K++ILG+G + IGQA EF Sbjct: 405 TITSVLPKPALVASRVEVSKVLILGSGGLSIGQAGEF 441
>CPSM_MOUSE (Q8C196) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1500 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 312 TVRHFAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 T+ +P V K++ILG+G + IGQA EF Sbjct: 405 TITSVLPKPALVASRVEVSKVLILGSGGLSIGQAGEF 441
>CARY_LACPL (Q9RLS9) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 1020 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 + I ++G+GPI IGQA EF Sbjct: 7 IHSIAVIGSGPIKIGQAAEF 26
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 11 APLIPLQKNPTSPSPPSTLHFAAASSTPPTLCAP 112 AP P +P SP+PPS A S +PP+ P Sbjct: 112 APPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPP 145
>PYR1_MESAU (P08955) CAD protein [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2); Dihydroorotase (EC 3.5.2.3)] Length = 2225 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 345 GGQLAGVKKIMILGAGPIVIGQACEF 422 G L +K++ILG+G + IGQA EF Sbjct: 387 GSGLPPPRKVLILGSGGLSIGQAGEF 412
>SF3B2_HUMAN (Q13435) Splicing factor 3B subunit 2 (Spliceosome-associated| protein 145) (SAP 145) (SF3b150) (Pre-mRNA splicing factor SF3b 145 kDa subunit) Length = 872 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 17 LIPLQKNPTSPSPPSTLHFAAASSTPPTLCAPP 115 L PLQ P P PP L + PP L PP Sbjct: 76 LPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPP 108
>CPSM_RANCA (Q91293) Carbamoyl-phosphate synthase [ammonia], mitochondrial| precursor (EC 6.3.4.16) (Carbamoyl-phosphate synthetase I) (CPSase I) Length = 1496 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 312 TVRHFAAEPTKGGQLAGVKKIMILGAGPIVIGQACEF 422 T+ +P + V K++ILG+G + IGQA EF Sbjct: 402 TLTSVMPKPALQSKRIDVAKVLILGSGGLSIGQAGEF 438
>PYR1_SCHPO (Q09794) Protein ura1 [Includes: Glutamine-dependent| carbamoyl-phosphate synthase (EC 6.3.5.5); Aspartate carbamoyltransferase (EC 2.1.3.2)] Length = 2244 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 354 LAGVKKIMILGAGPIVIGQACEF 422 L K+++ILG+G + IGQA EF Sbjct: 471 LVDAKRVLILGSGGLSIGQAGEF 493
>NFIC_CHICK (P17926) Nuclear factor 1 C-type (Nuclear factor 1/C) (NF1-C)| (NFI-C) (NF-I/C) (CCAAT-box-binding transcription factor) (CTF) (TGGCA-binding protein) Length = 439 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 2 QLHAPLIPLQKN-PTSPSPPSTLHFAAASSTPPT 100 Q H P+I + SP P STLHF S P T Sbjct: 351 QHHRPVIAVHSGIARSPHPSSTLHFPTTSILPQT 384
>CARB_SCHPO (O94313) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase, ammonia chain) Length = 1160 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 342 KGGQLAGVKKIMILGAGPIVIGQACEF 422 K + VKK++++G+G + IGQA EF Sbjct: 79 KAAEHEKVKKVVVVGSGGLSIGQAGEF 105
>CARB2_AQUAE (O67233) Carbamoyl-phosphate synthase large chain, C-terminal| section (EC 6.3.5.5) (Carbamoyl-phosphate synthetase ammonia chain) Length = 537 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 366 KKIMILGAGPIVIGQACEF 422 KK++ILG+GP IGQ EF Sbjct: 3 KKVVILGSGPNRIGQGIEF 21
>YC9F_SCHPO (Q09889) Hypothetical protein C584.15c in chromosome III| Length = 594 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 1 TVTRPLNPSTKKPYIPIAPFHPPLRRRFLNTTNLV 105 T+ P PST P +P HP R+ L++TNLV Sbjct: 558 TIIAPALPSTPAPPLPS---HPMATRKSLSSTNLV 589
>CARB_TRICU (P46056) Carbamoyl-phosphate synthase arginine-specific large chain| (EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase, ammonia chain) Length = 1176 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +3 Query: 363 VKKIMILGAGPIVIGQACEF 422 VKK++++G+G + IGQA EF Sbjct: 75 VKKVLVVGSGGLSIGQAGEF 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.132 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,728,690 Number of Sequences: 219361 Number of extensions: 429135 Number of successful extensions: 2729 Number of sequences better than 10.0: 124 Number of HSP's better than 10.0 without gapping: 2307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2698 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)