| Clone Name | bastl09d08 |
|---|---|
| Clone Library Name | barley_pub |
>NIPA_PONPY (Q5R8V9) Nuclear-interacting partner of ALK (Nuclear-interacting| partner of anaplastic lymphoma kinase) (Zinc finger C3HC-type protein 1) Length = 502 Score = 32.3 bits (72), Expect = 0.58 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +3 Query: 303 SLSTNAVGAAMDFSQPSCRPWERGDLLHRLATFKPSTWASKPKAASSLACA 455 S ++ +V + QPS + R+ TF WA KP S L CA Sbjct: 53 SATSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPPELSPLVCA 103
>TILS_PROMM (Q7V987) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 343 Score = 32.0 bits (71), Expect = 0.76 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 30 IPTRSHLTWLWLEPASRPSAPAMREEVRSSSAAPADPP 143 I R+ L WL+ + PS PA++ E S S AP PP Sbjct: 282 ITARTTLLAYWLKRSGAPSLPAVQLEQISQSIAPGKPP 319
>NIPA_HUMAN (Q86WB0) Nuclear-interacting partner of ALK (Nuclear-interacting| partner of anaplastic lymphoma kinase) (hNIPA) (Zinc finger C3HC-type protein 1) Length = 502 Score = 31.6 bits (70), Expect = 0.99 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +3 Query: 303 SLSTNAVGAAMDFSQPSCRPWERGDLLHRLATFKPSTWASKPKAASSLACA 455 S ++ +V + QPS + R+ TF WA KP S L CA Sbjct: 53 SATSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCA 103
>BMP2K_HUMAN (Q9NSY1) BMP-2-inducible protein kinase (EC 2.7.11.1) (BIKe)| Length = 1161 Score = 29.3 bits (64), Expect = 4.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 343 HNHHVDHGNEEIYFIDWPHLSLQHGLLNQRLLVH 444 H+HH H ++ Y + H + Q +L Q+ L+H Sbjct: 488 HHHHHHHLLQDAYMQQYQHATQQQQMLQQQFLMH 521
>NIPA_MOUSE (Q80YV2) Nuclear-interacting partner of ALK (Nuclear-interacting| partner of anaplastic lymphoma kinase) (mNIPA) (Zinc finger C3HC-type protein 1) Length = 501 Score = 28.9 bits (63), Expect = 6.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 384 HRLATFKPSTWASKPKAASSLACA 455 HR+ TF WA KP S L CA Sbjct: 80 HRVETFSSLKWAGKPPELSPLICA 103
>D1IP_HUMAN (Q9NYX4) D1 dopamine receptor-interacting protein calcyon| Length = 217 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 33 PTRSHLTWLWLEPASRPSAPAMREEVRSSSAAPADPP 143 PT++ EP +PSA A +E R ++ + A PP Sbjct: 179 PTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPP 215 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,888,416 Number of Sequences: 219361 Number of extensions: 829471 Number of successful extensions: 2457 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2451 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)