Clone Name | bastl09c06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precu... | 31 | 0.94 | 2 | FOXL2_MOUSE (O88470) Forkhead box protein L2 (Pituitary forkhead... | 28 | 8.0 | 3 | FOXL2_HUMAN (P58012) Forkhead box protein L2 | 28 | 8.0 |
---|
>CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precursor (EC| 3.4.22.-) (Cysteine protease-related 3) Length = 370 Score = 30.8 bits (68), Expect = 0.94 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 5/39 (12%) Frame = +3 Query: 168 YELGDADLAFRL-----HYLRGVYYYSAGKVVRGVTTKV 269 Y G + ++++ HY GVY+Y++GK+V G K+ Sbjct: 250 YHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKI 288
>FOXL2_MOUSE (O88470) Forkhead box protein L2 (Pituitary forkhead factor)| (P-Frk) Length = 375 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 118 PCTAAVASPSSPMPT-APRNSWVCVQAREFSLCECT 14 P + A A+P +P PT AP + C + E ++ C+ Sbjct: 323 PASPATAAPPAPAPTSAPGLQFACARQPELAMMHCS 358
>FOXL2_HUMAN (P58012) Forkhead box protein L2| Length = 376 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 118 PCTAAVASPSSPMPT-APRNSWVCVQAREFSLCECT 14 P + A A+P +P PT AP + C + E ++ C+ Sbjct: 324 PASPATAAPPAPAPTSAPGLQFACARQPELAMMHCS 359 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,482,657 Number of Sequences: 219361 Number of extensions: 241300 Number of successful extensions: 1015 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1015 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)