Clone Name | bastl09c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NPHN_HUMAN (O60500) Nephrin precursor (Renal glomerulus-specific... | 29 | 3.9 |
---|
>NPHN_HUMAN (O60500) Nephrin precursor (Renal glomerulus-specific cell adhesion| receptor) Length = 1241 Score = 29.3 bits (64), Expect = 3.9 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = -2 Query: 407 GLRRHHPRNGSSLHRPSHQSRRRRLCTLQFHHRQQRIQTAHGTDGT 270 GL H R G SL P L TLQ+ Q + TA GT+ T Sbjct: 249 GLDEGHVRAGQSLELPCVARGGNPLATLQWLKNGQPVSTAWGTEHT 294 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,559,993 Number of Sequences: 219361 Number of extensions: 204183 Number of successful extensions: 1083 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)