Clone Name | bastl09b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | V_MUMP1 (P60167) Nonstructural protein V (Nonstructural protein ... | 30 | 1.4 | 2 | PODO_MOUSE (Q91X05) Podocin | 28 | 5.3 | 3 | CO1A2_RANCA (O42350) Collagen alpha-2(I) chain precursor | 28 | 5.3 | 4 | K1849_HUMAN (Q96JH8) Protein KIAA1849 | 28 | 6.9 | 5 | Y1999_CORGL (Q8NP26) UPF0061 protein Cgl1999/cg2190 | 27 | 9.0 | 6 | DADA2_RALSO (Q8XX54) D-amino acid dehydrogenase 2 small subunit ... | 27 | 9.0 | 7 | COL39_CAEEL (Q09455) Cuticle collagen 39 precursor | 27 | 9.0 |
---|
>V_MUMP1 (P60167) Nonstructural protein V (Nonstructural protein NS1)| Length = 224 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 381 TPGRGFWRPNRGPAGRAKPDLDGERRRWGEDWIRGAQR 268 TP F R R P R G RR W W++G R Sbjct: 147 TPVTEFKRGGREPCSRPDNPRGGHRREWSLSWVQGEVR 184
>PODO_MOUSE (Q91X05) Podocin| Length = 385 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 360 RPNRGPAGRAKPDLDGERRRWGEDWIRGAQR 268 + RG GRA+PD ER+ G RG R Sbjct: 28 KAGRGSRGRARPDAGAERQSTGRTATRGEPR 58
>CO1A2_RANCA (O42350) Collagen alpha-2(I) chain precursor| Length = 1355 Score = 28.1 bits (61), Expect = 5.3 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 387 HGTPGRGFWRPNRGPAG-RAKPDLDGERRRWGEDWIRGAQREDSER 253 +G PG+ + N+GP+G R P DG G + GA E E+ Sbjct: 492 NGEPGKNGDKGNQGPSGNRGAPGPDGNNGAQGPAGLGGATGEKGEQ 537
>K1849_HUMAN (Q96JH8) Protein KIAA1849| Length = 1073 Score = 27.7 bits (60), Expect = 6.9 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -2 Query: 378 PGRGFWRPNRGPAGRAKPDLDGERRRWGEDWIRGAQRE 265 PG W + GP G+A P ER+R G +RGA E Sbjct: 912 PGDPDWPESGGPCGKALP----ERQRNGLSGLRGAAPE 945
>Y1999_CORGL (Q8NP26) UPF0061 protein Cgl1999/cg2190| Length = 474 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 33 GWFVHRVGDGRGLLLGWAR 89 G FV +GDGR LLLG AR Sbjct: 82 GQFVASLGDGRALLLGEAR 100
>DADA2_RALSO (Q8XX54) D-amino acid dehydrogenase 2 small subunit (EC 1.4.99.1)| Length = 425 Score = 27.3 bits (59), Expect = 9.0 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 363 WRPNRGPAGRAKPDLDGERRRWGEDWIRGAQREDSER 253 W R R KP LD RWG +I RE ++R Sbjct: 67 WLLRRDSPLRLKPSLDPVLLRWGLRFIAACNRERADR 103
>COL39_CAEEL (Q09455) Cuticle collagen 39 precursor| Length = 323 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 384 GTPGRGFWRPNRGPAGRAKPDLDGERRRWGEDWIRGAQRED 262 G PG+ + +GPAG A P DG+ + G+D GA D Sbjct: 221 GQPGQSGGQGQQGPAGPAGP--DGQPGQPGQDGQAGAPGND 259 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,382,467 Number of Sequences: 219361 Number of extensions: 581861 Number of successful extensions: 2052 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2052 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)