| Clone Name | bastl08h01 |
|---|---|
| Clone Library Name | barley_pub |
>ATIN_BHV1P (P30020) Alpha trans-inducing protein (Alpha-TIF)| Length = 504 Score = 31.6 bits (70), Expect = 0.87 Identities = 19/39 (48%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 311 PDPPPVRLGQPGAHGLAR-RGCPPPRHACQGPGQELAGR 424 P P PVR G GL+R RG P P AC GP + GR Sbjct: 443 PGPSPVRSGL----GLSRARGSPGPGPACGGPSRARGGR 477
>NOTC4_MOUSE (P31695) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| [Contains: Transforming protein Int-3; Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 1964 Score = 30.8 bits (68), Expect = 1.5 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 311 PDPPPVRLGQPGAHGLARRGCPPPRHA-CQGPGQELAGRGCS 433 PD P R +PGA G RG A C GPG + G CS Sbjct: 1159 PDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCS 1200
>YP85_CAEEL (Q09442) Putative RNA-binding protein C08B11.5| Length = 388 Score = 30.0 bits (66), Expect = 2.5 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 12/44 (27%) Frame = +2 Query: 311 PDPPPVRLGQPGAHGL------------ARRGCPPPRHACQGPG 406 P PPP R G PG G+ PPPR+ GPG Sbjct: 318 PPPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPPPPPRYPSAGPG 361
>TAF4_HUMAN (O00268) Transcription initiation factor TFIID subunit 4| (Transcription initiation factor TFIID 135 kDa subunit) (TAF(II)135) (TAFII-135) (TAFII135) (TAFII-130) (TAFII130) Length = 1085 Score = 29.3 bits (64), Expect = 4.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 311 PDPPPVRLGQPGAHGLARRGCPPPR 385 P+PPP +PG G R G P PR Sbjct: 87 PEPPPAGRARPGGGGPQRPGPPSPR 111
>SAM68_CHICK (Q8UUW7) KH domain-containing, RNA-binding, signal| transduction-associated protein 1 (Src-associated in mitosis 68 kDa protein) (Sam68) Length = 433 Score = 28.9 bits (63), Expect = 5.7 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 314 DPPPVRLGQ-PGAHGLARRGCPPPRHACQGPGQELAG 421 D R+G+ PG G AR+G P PR + +G G AG Sbjct: 5 DDSSARMGRGPGGPGSARQGGPNPRRSPRGGGGRGAG 41
>GFRA4_HUMAN (Q9GZZ7) GDNF family receptor alpha-4 precursor (GFR-alpha-4)| (Persephin receptor) Length = 299 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 317 PPPVRLGQPGAHGLARRGCPPPRHACQGPGQELAGR 424 PP + PG GL PR GPG+ L R Sbjct: 153 PPAAQASPPGLSGLVHPSAQRPRRLPAGPGRPLPAR 188
>SSXT_HUMAN (Q15532) SSXT protein (Synovial sarcoma, translocated to X| chromosome) (SYT protein) Length = 418 Score = 28.1 bits (61), Expect = 9.7 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +2 Query: 317 PPPVRLGQ--PGAHGLARRGCPPPRHACQGPGQELAGR 424 PP +GQ G H + +R PP R QGP Q+ +G+ Sbjct: 230 PPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQ 267
>ZNHI4_HUMAN (Q9C086) Zinc finger HIT domain-containing protein 4| (PAP-1-associated protein 1) (PAPA-1) (High mobility group AT-hook 1-like 4) Length = 343 Score = 28.1 bits (61), Expect = 9.7 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 311 PDPPPVRLGQPGAHGLARRGCPPPR-HACQGPGQELAGRGCSR 436 P PP R PG CP PR +AC GQ L C R Sbjct: 289 PSGPPPRCSVPG--------CPHPRRYACSRTGQALCSLQCYR 323
>PYGO_DROME (Q9V9W8) Protein pygopus (Protein gammy legs)| Length = 815 Score = 28.1 bits (61), Expect = 9.7 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 317 PPPVRLGQPGAHGLARRGCPPPRHACQGPGQELAG 421 PPP +G PG HG G PP H GP + G Sbjct: 596 PPPHMMGGPGMHG-GPAGMPP--HMGGGPNPHMMG 627
>RARB_MOUSE (P22605) Retinoic acid receptor beta (RAR-beta)| Length = 482 Score = 28.1 bits (61), Expect = 9.7 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +2 Query: 317 PPPVR-LGQPGAHGLARRGCPPPRHACQGPGQELAGRGCSR 436 PP +R L P HGL G PPP C P G+ C R Sbjct: 30 PPVIRGLSLPPLHGL--HGHPPPS-GCSTPSPASVGQACQR 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.142 0.512 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,537,003 Number of Sequences: 219361 Number of extensions: 408284 Number of successful extensions: 1243 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1025 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)