Clone Name | bastl08g11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 33 | 0.16 | 2 | YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II | 28 | 6.8 |
---|
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 33.1 bits (74), Expect = 0.16 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +2 Query: 356 ADDENPEDFIDPETP 400 A +ENPEDF+DPETP Sbjct: 111 ASEENPEDFVDPETP 125
>YNB2_SCHPO (Q9USS8) Hypothetical protein C4.02c in chromosome II| Length = 456 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 122 EIGWYGWSRRRGRAPALAWTLRSTARAECP*QVRVLRNF 6 EIG G + + AP+ W LR+ R EC +R R + Sbjct: 392 EIGDIGAQQWKTLAPSERWILRTNIRKECTYDIRYKRPY 430 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,433,323 Number of Sequences: 219361 Number of extensions: 177882 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 1359926328 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)