| Clone Name | bastl08e01 |
|---|---|
| Clone Library Name | barley_pub |
>IRF3_CHICK (Q90643) Interferon regulatory factor 3 (IRF-3)| Length = 491 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 6/48 (12%) Frame = +1 Query: 352 EWKLNFRCSLTMT------SDKGRASKKVAEGSSSALAVPDGRASSGP 477 +WK NFRC+L T D+ + + + + A VP+ R S GP Sbjct: 80 KWKTNFRCALRSTHMFMLLEDRSKCNDDPHKVYAVASGVPNDRGSGGP 127
>MBN3_MOUSE (Q8R003) Muscleblind-like X-linked protein (Muscleblind-like| protein 3) (Cys3His CCG1-required protein) (MCHCR protein) Length = 342 Score = 29.6 bits (65), Expect = 4.2 Identities = 29/99 (29%), Positives = 36/99 (36%), Gaps = 17/99 (17%) Frame = -1 Query: 463 LFHQAQPKQRMNPQRPSLKPFPCHLSL*VNTENSISTL*QKPGKGL---------RIIII 311 +F Q N Q SL FP + SL N + + PG GL ++I Sbjct: 97 MFAQHMQLMLQNAQMSSLASFPMNPSLAANPAMAFNPYMTHPGMGLVPAELLPNGPVLIS 156 Query: 310 SNPQRVLQGVVSQKENRS*ALRRIR--------RGASAC 218 NP L GV K R+ L R RG S C Sbjct: 157 GNPPLALPGVPGPKPIRTDRLEVCREFQRGNCTRGESEC 195
>TNAP3_MOUSE (Q60769) Tumor necrosis factor, alpha-induced protein 3 (EC| 3.-.-.-) (Putative DNA binding protein A20) (Zinc finger protein A20) Length = 775 Score = 28.9 bits (63), Expect = 7.2 Identities = 26/95 (27%), Positives = 38/95 (40%), Gaps = 7/95 (7%) Frame = +3 Query: 48 RIHQFKPPTRREAERRLI--FISNPIKKERDFSFCAPVIKDLVAEAAGGSGG-----ACQ 206 R QF P R + LI + ++ ++ ++C V K LVA G G ACQ Sbjct: 52 RTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCREVRK-LVALKTNGDGNCLMHAACQ 110 Query: 207 SLLGQADAPRRIRRRAYDLFSFCDTTP*RTRWGFE 311 + G D +R+ DT + RW E Sbjct: 111 YMWGVQDTDLVLRKALCSTLKETDTRNFKFRWQLE 145
>NED1_SCHPO (Q9UUJ6) Nuclear elongation and deformation protein 1| Length = 656 Score = 28.9 bits (63), Expect = 7.2 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 4/77 (5%) Frame = -3 Query: 419 TFFEALPLSLVIVSEHRKFN--FHSVAEAREGSKNHYNFKPPASPSRSCVA--EGE*VIG 252 TF + P+ ++ E + N FH+ +A++ ++ Y PPASPSR+ + ++ Sbjct: 248 TFKDEFPMIEKLLREDEEGNLWFHASEDAKKFAEV-YGHSPPASPSRTPASPKSDSALMD 306 Query: 251 SPADPTRRIRLPQQRLT 201 +D +RR L +Q L+ Sbjct: 307 EDSDLSRRHSLSEQSLS 323
>HIS8_CORDI (P60999) Histidinol-phosphate aminotransferase (EC 2.6.1.9)| (Imidazole acetol-phosphate transaminase) Length = 366 Score = 28.9 bits (63), Expect = 7.2 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 7 EPSFSLHFLLFQSVASTNLNLPREGKRREDL 99 +PS+S+H +L Q +T +N PR+ + R D+ Sbjct: 120 QPSYSMHPILAQGTQTTFINCPRDKEFRIDV 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,021,230 Number of Sequences: 219361 Number of extensions: 1203221 Number of successful extensions: 3510 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3508 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)