| Clone Name | bastl08d05 |
|---|---|
| Clone Library Name | barley_pub |
>KR105_HUMAN (P60370) Keratin-associated protein 10-5 (Keratin-associated| protein 10.5) (High sulfur keratin-associated protein 10.5) (Keratin-associated protein 18-5) (Keratin-associated protein 18.5) Length = 271 Score = 30.8 bits (68), Expect = 1.5 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 106 TSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRC 246 T +SC ++SP Q A P+PC+ G + P CC A+ C Sbjct: 42 TPVSC-VSSPCC---QAACEPSPCQSGCTSSCTPSCCQPACCASSPC 84
>KR103_HUMAN (P60369) Keratin-associated protein 10-3 (Keratin-associated| protein 10.3) (High sulfur keratin-associated protein 10.3) (Keratin-associated protein 18-3) (Keratin-associated protein 18.3) Length = 221 Score = 30.4 bits (67), Expect = 1.9 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +1 Query: 106 TSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCC--SSCTAAALRCS 249 T +SC ++SP Q A P+PC+ G + P CC SSC A S Sbjct: 48 TPVSC-VSSPCC---QAACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSS 93 Score = 28.9 bits (63), Expect = 5.5 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +1 Query: 97 ATATSLSCSIASPASLRVQTADR-----PAPCRCG*AVTARPPCCSSCTAAALRC 246 A T+ C +S SL + R P P C A T +P CC + +L C Sbjct: 145 ACCTTSCCRPSSSVSLLCRPVCRSTYCVPIPSCCAPASTCQPSCCRPASCVSLLC 199
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 30.0 bits (66), Expect = 2.5 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 Query: 260 RRREEQRSAAAVQDEQQGGRAVTA*PQRHGAGRSAVCTRS 141 RRR + S + V+D + GGRA A P A R +RS Sbjct: 833 RRRRDSPSRSPVRDRESGGRAAAAAPGNSEARRGRSYSRS 872
>MT2_MOUSE (P02798) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 61 Score = 30.0 bits (66), Expect = 2.5 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS AS S A + C+C + + CCS C +CS Sbjct: 4 NCSCASDGSCSCAGACKCKQCKC---TSCKKSCCSCCPVGCAKCS 45
>MT2B_PIG (P79380) Metallothionein-2B (MT-2B) (Metallothionein-IIB) (MT-IIB)| Length = 61 Score = 30.0 bits (66), Expect = 2.5 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS A+ S + + CRC + + CCS C A RC+ Sbjct: 4 NCSCAAGGSCTCAGSCKCKDCRC---TSCKKSCCSCCPAGCARCA 45
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 29.6 bits (65), Expect = 3.2 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +1 Query: 88 SPLATATSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCC--SSCTAAALRCS 249 +P T + ++ +S Q A P+PC+ G + P CC SSC A S Sbjct: 38 APAPCLTLVCTPVSRVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSS 93
>MT2_MESAU (P17808) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 61 Score = 29.6 bits (65), Expect = 3.2 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS A+ S + + C+C T + CCS C +CS Sbjct: 4 NCSCATDGSCSCSGSCKCKECKC---TTCKKSCCSCCPVGCAKCS 45
>MT2_CRILO (P68041) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 61 Score = 29.3 bits (64), Expect = 4.2 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS A+ S + + C+C T + CCS C +CS Sbjct: 4 NCSCATDGSCSCAGSCKCKECKC---TTCKKSCCSCCPVGCAKCS 45
>MT2_CRIGR (P67981) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| Length = 61 Score = 29.3 bits (64), Expect = 4.2 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS A+ S + + C+C T + CCS C +CS Sbjct: 4 NCSCATDGSCSCAGSCKCKECKC---TTCKKSCCSCCPVGCAKCS 45
>MT1D_PIG (P79377) Metallothionein-1D (MT-1D) (Metallothionein-ID) (MT-ID)| Length = 61 Score = 29.3 bits (64), Expect = 4.2 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS ++ S T+ CRC + + CCS C A +C+ Sbjct: 4 NCSCSTGGSCSCATSCTCKACRC---TSCKKSCCSCCPAGCAKCA 45
>CCDC4_HUMAN (Q6ZU67) Coiled-coil domain-containing protein 4| Length = 530 Score = 28.9 bits (63), Expect = 5.5 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +1 Query: 73 PLPHSSPLA--TATSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTA 231 P P P A A S+S S P + Q++ P P R A ++ P C+ T+ Sbjct: 51 PPPPPPPFAPHAAVSISSSEPPPQQFQAQSSYPPGPGRAAAAASSSSPSCTPATS 105
>HXB5_HUMAN (P09067) Homeobox protein Hox-B5 (Hox-2A) (HHO.C10) (HU-1)| Length = 269 Score = 28.5 bits (62), Expect = 7.2 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +1 Query: 64 RAHPLPHSSPLATATSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCCS 219 RA P P P + SCS++SP SL PC G + A+P S Sbjct: 74 RAFPAPAQEPRFRQAASSCSLSSPESL---------PCTNGDSHGAKPSASS 116
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 28.1 bits (61), Expect = 9.4 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Frame = +1 Query: 91 PLATATSLSCS-----IASPASLRVQTADRPAPCRCG*AVTARPPCC--SSCTAAALRCS 249 P+ + S SC ++ +S Q P+PC+ G + P CC SSC A S Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSS 222
>WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7.11.1) (Protein| kinase with no lysine 2) (Protein kinase, lysine-deficient 2) Length = 2297 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 424 QAPEQAPPRPVSFQERREPRGSERSCLMACRPCRSAS 314 +APE +PP P+S +G R + C P R A+ Sbjct: 1325 EAPESSPPLPLSSLPPEASQGPCRGLTLPCLPWRRAA 1361
>MT2E_RABIT (P80292) Metallothionein-2E (MT-2E) (Metallothionein-IIE) (MT-IIE)| Length = 61 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS A+ S ++ + C+C + + CCS C A +C+ Sbjct: 4 NCSCATRDSCACASSCKCKECKC---TSCKKSCCSCCPAGCTKCA 45
>MT2D_RABIT (P80291) Metallothionein-2D (MT-2D) (Metallothionein-IID) (MT-IID)| Length = 61 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS A+ S ++ + C+C + + CCS C A +C+ Sbjct: 4 NCSCATRDSCACASSCKCKECKC---TSCKKSCCSCCPAGCTKCA 45
>MT2B_RABIT (P80289) Metallothionein-2B (MT-2B) (Metallothionein-IIB) (MT-IIB)| Length = 61 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS A+ S ++ + C+C + + CCS C A +C+ Sbjct: 4 NCSCATGDSCTCASSCKCKECKC---TSCKKSCCSCCPAGCTKCA 45
>MT1C_PIG (P79376) Metallothionein-1C (MT-1C) (Metallothionein-IC) (MT-IC)| Length = 61 Score = 28.1 bits (61), Expect = 9.4 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +1 Query: 103 ATSLSCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +T SCS A + + CRC + + CCS C A RC+ Sbjct: 8 STGGSCSCAGSCTCKA--------CRC---TSCKKSCCSCCPAGCARCA 45
>MT1A_RABIT (P11957) Metallothionein-1A (MT-1A) (Metallothionein-IA) (MT-IA)| Length = 61 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +1 Query: 115 SCSIASPASLRVQTADRPAPCRCG*AVTARPPCCSSCTAAALRCS 249 +CS A+ S ++ + C+C + + CCS C A +C+ Sbjct: 4 NCSCATGNSCTCASSCKCKECKC---TSCKKSCCSCCPAGCTKCA 45
>DEOC_NOCFA (Q5YP36) Deoxyribose-phosphate aldolase (EC 4.1.2.4)| (Phosphodeoxyriboaldolase) (Deoxyriboaldolase) (DERA) Length = 222 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 226 CRTSSRAAARLPPSRSGMAPAGLQSVHEVK 137 CR + RA A + +G PAG SVH V+ Sbjct: 144 CRVAERAGADFVKTSTGFHPAGGASVHAVR 173
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 28.1 bits (61), Expect = 9.4 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Frame = +1 Query: 91 PLATATSLSCS-----IASPASLRVQTADRPAPCRCG*AVTARPPCC--SSCTAAALRCS 249 P+ + S SC ++ +S Q P+PC+ G + P CC SSC A S Sbjct: 163 PVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCKPACCTSS 222
>ECAR_ECHCA (Q90495) Ecarin precursor (EC 3.4.24.-)| Length = 616 Score = 28.1 bits (61), Expect = 9.4 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 124 IASPASLRVQTADRPAPCRCG*AVTARPPCCSSCT 228 IASPA + + C CG R PCC + T Sbjct: 402 IASPAVCGNEIWEEGEECDCGSPADCRNPCCDAAT 436 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,579,733 Number of Sequences: 219361 Number of extensions: 452895 Number of successful extensions: 2131 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2112 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)