Clone Name | bastl08b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | IPO11_MOUSE (Q8K2V6) Importin-11 (Imp11) (Ran-binding protein 11... | 32 | 0.47 | 2 | IPO11_HUMAN (Q9UI26) Importin-11 (Imp11) (Ran-binding protein 11... | 32 | 0.47 | 3 | CAPK_STAAU (P39860) Protein capK | 28 | 5.2 |
---|
>IPO11_MOUSE (Q8K2V6) Importin-11 (Imp11) (Ran-binding protein 11) (RanBP11)| Length = 975 Score = 31.6 bits (70), Expect = 0.47 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +1 Query: 292 VTQILLSAQSADGSIRKHAEESLKQFQEQNLPGF 393 V Q+L A S D ++ K AEE LKQ++ Q PGF Sbjct: 10 VLQVLTQATSQDTAVLKPAEEQLKQWETQ--PGF 41
>IPO11_HUMAN (Q9UI26) Importin-11 (Imp11) (Ran-binding protein 11) (RanBP11)| Length = 975 Score = 31.6 bits (70), Expect = 0.47 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +1 Query: 292 VTQILLSAQSADGSIRKHAEESLKQFQEQNLPGF 393 V Q+L A S D ++ K AEE LKQ++ Q PGF Sbjct: 10 VLQVLTQATSQDTAVLKPAEEQLKQWETQ--PGF 41
>CAPK_STAAU (P39860) Protein capK| Length = 449 Score = 28.1 bits (61), Expect = 5.2 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 292 VTQILLSAQSADGSIRKHAEESLKQFQEQNLPGF 393 + Q+++SA ADG K+ + L +FQ + L G+ Sbjct: 183 LNQLMISAYHADGENLKYYIKKLNKFQPETLDGY 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,005,841 Number of Sequences: 219361 Number of extensions: 572619 Number of successful extensions: 1071 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1071 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)