Clone Name | bastl08b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NKX31_MOUSE (P97436) Homeobox protein Nkx-3.1 | 28 | 7.9 | 2 | RLUD_PASMU (Q9CKA6) Ribosomal large subunit pseudouridine syntha... | 28 | 7.9 |
---|
>NKX31_MOUSE (P97436) Homeobox protein Nkx-3.1| Length = 237 Score = 28.5 bits (62), Expect = 7.9 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 121 NPAHSSAPQSISTPTRSIGGTFCSKSRGIAPESPTAETHT 240 NP HS P+ S P G RG+APE P + H+ Sbjct: 52 NPQHSPDPRRDSAPEPDKAG-----GRGVAPEDPPSIRHS 86
>RLUD_PASMU (Q9CKA6) Ribosomal large subunit pseudouridine synthase D (EC| 5.4.99.-) (rRNA-uridine isomerase D) (rRNA pseudouridylate synthase D) Length = 324 Score = 28.5 bits (62), Expect = 7.9 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 7/48 (14%) Frame = -2 Query: 418 VSKIGVASKRDRVPSGC-------PRQSKGSRRDQRRKITREPSLVAC 296 V + G+ + D+ +G P Q+K R Q+RKITRE +AC Sbjct: 128 VPRAGIVHRLDKDTTGLMVIAKTIPAQTKLVRDLQKRKITREYEAIAC 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,224,877 Number of Sequences: 219361 Number of extensions: 587781 Number of successful extensions: 2316 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2316 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)