ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl07g04 |
|---|---|
| Clone Library Name | barley_pub |
>XYL1_ARATH (Q9S7Y7) Alpha-xylosidase precursor (EC 3.2.1.-)| Length = 915 Score = 38.9 bits (89), Expect = 0.007 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = +3 Query: 357 GFGYRLVSLVQRPNGGGLVGLLQVKRRSSTFGPDI 461 G GYRLVS+ + P+GG +G LQVK+++ +G DI Sbjct: 32 GKGYRLVSIEESPDGG-FIGYLQVKQKNKIYGSDI 65
>CS007_HUMAN (Q9UPT8) Zinc finger CCCH-type domain-containing protein C19orf7| Length = 1303 Score = 33.1 bits (74), Expect = 0.38 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = -1 Query: 456 QGRRWRSGASPGGGLRGRRRWVAGRGTPAGTRTR 355 Q RR + G+S G G RGR R GRG+ G+R R Sbjct: 226 QYRRAKEGSSRGRGSRGRGRGYRGRGSRGGSRGR 259
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 33.1 bits (74), Expect = 0.38 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = -1 Query: 456 QGRRWRSGASPGGGLRGRRRWVAGRGTPAGTRTR 355 Q RR + G+S G G RGR R GRG+ G+R R Sbjct: 226 QYRRAKEGSSRGRGSRGRGRGYRGRGSRGGSRGR 259
>FUT4_PANTR (Q659K9) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) Length = 405 Score = 30.8 bits (68), Expect = 1.9 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 14/67 (20%) Frame = -1 Query: 429 SPGGGLRGRRRWVAGRGTP--------AGTR-----TRPAWVPL-PAPWPCDWPSRLRRR 292 SP GRRRW GRG P AG T W L P PW PSR Sbjct: 7 SPTAAAGGRRRWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASPTPSRPVGV 66 Query: 291 HCWCRPW 271 W P+ Sbjct: 67 LLWWEPF 73
>CYCG_RHOS4 (Q53143) Diheme cytochrome c-type| Length = 296 Score = 30.4 bits (67), Expect = 2.5 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 423 GGGLRGRRRWVAGRGTPAGTRTRPAWVPLPAPW 325 G GLR + RW+AG P G T P P W Sbjct: 211 GLGLRDKSRWLAGGPNPEGRGTIPNITPAKLDW 243
>AVEN_MOUSE (Q9D9K3) Cell death regulator Aven| Length = 342 Score = 30.4 bits (67), Expect = 2.5 Identities = 20/36 (55%), Positives = 22/36 (61%) Frame = -1 Query: 468 RRGCQGRRWRSGASPGGGLRGRRRWVAGRGTPAGTR 361 RRG +GR +R G GGGLRG R GRG A TR Sbjct: 44 RRG-RGRGFRRGRG-GGGLRGGRWEPGGRGGGASTR 77
>ROA1_SCHAM (P21522) Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog| Length = 342 Score = 30.0 bits (66), Expect = 3.2 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -1 Query: 465 RGCQGRRWRSGASPGGGLRGRRRWVAGRGTPAGTR 361 RG G RW G GGG+ G RW G G G R Sbjct: 238 RGGGGDRWGGG---GGGMGGGDRWGGGGGMGGGDR 269
>AGLU_BETVU (O04931) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 913 Score = 30.0 bits (66), Expect = 3.2 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 357 GFGYRLVSL-VQRPNGGGLVGLLQVKRRSSTFGPDI 461 G+GY++ + V G L LLQ+ R S +GPDI Sbjct: 42 GYGYQVKNAKVDNSTGKSLTALLQLIRNSPVYGPDI 77
>PO5F1_BOVIN (O97552) POU domain, class 5, transcription factor 1| (Octamer-binding transcription factor 3) (Oct-3) (Oct-4) Length = 360 Score = 30.0 bits (66), Expect = 3.2 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 6/60 (10%) Frame = -1 Query: 435 GASPGG---GLRGRRRWVAGRGTPAGTRTRPAWVPLPAPW---PCDWPSRLRRRHCWCRP 274 G PGG G R W++ +G P G+ P VP W PC P L +C P Sbjct: 19 GDGPGGPEPGWVDPRTWMSFQGPPGGSGIGPGVVPGAEVWGLPPCPPPYDLCGGMAYCAP 78
>NBEA_DROME (Q9W4E2) Protein neurobeachin (Protein rugose) (A-kinase anchor| protein 550) (AKAP 550) (dAKAP550) Length = 3584 Score = 29.6 bits (65), Expect = 4.2 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = -1 Query: 435 GASPGGGLRGRRRWVAGRGTPAGTRTRPAWVPLPAP-----WPCDWPSR 304 GA GGG+ + G+G P+ R RP +P+ AP P PSR Sbjct: 2458 GAGSGGGVNSGQ----GQGVPSNQRPRPEELPMKAPALVAQLPLTTPSR 2502
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 29.6 bits (65), Expect = 4.2 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Frame = -1 Query: 468 RRGCQGRRWRSGASPGGGLRG-----------RRRWVAGRGTPAGTRTRPAWVPLPAPWP 322 R G G+ SG+S GGG G +R W + + RP +PLP P P Sbjct: 1401 RPGPGGKAGSSGSSSGGGGAGPGGRTGPGRGDKRSWPSPKNRSRPPEERPPGLPLPPPPP 1460
>BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2157 Score = 29.3 bits (64), Expect = 5.5 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 11/60 (18%) Frame = -1 Query: 468 RRGCQGRRWRSGASPGGGLRG-----------RRRWVAGRGTPAGTRTRPAWVPLPAPWP 322 R G G+ SG+S GGG G +R W + + RP +PLP P P Sbjct: 1398 RPGPGGKAGSSGSSSGGGGGGPGGRTGPGRGDKRSWPSPKNRSRPPEERPPGLPLPPPPP 1457
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 28.9 bits (63), Expect = 7.2 Identities = 17/53 (32%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = -1 Query: 468 RRGCQGRRWRSGASPGG----GLRGRRRWVAGRGTPAGTRTRPAWVPLPAPWP 322 + G G GA PGG G +R W + + RP +PLP P P Sbjct: 1405 KTGGGGSSGGGGAGPGGRTGPGRGDKRSWPSPKNRSRPPEERPPGLPLPPPPP 1457
>XLNR_ASPNG (O42804) Transcriptional activator xlnR| Length = 875 Score = 28.5 bits (62), Expect = 9.4 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 354 PAWVPLPAPWPCDWPS 307 P W+PLP+P P ++PS Sbjct: 268 PGWLPLPSPSPANFPS 283
>PO2F1_CHICK (P15143) POU domain, class 2, transcription factor 1| (Octamer-binding transcription factor 1) (Oct-1) (OTF-1) (NF-A1) Length = 739 Score = 28.5 bits (62), Expect = 9.4 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +1 Query: 79 TRIITAPSVSLSIRPCSLSRSRSRACDIAAAQSTRTVRSTQRCSL---APLPTS 231 T I TAP S ++ SLS S S + I+ A S +TQ S +PL TS Sbjct: 503 TVISTAPPASSAVTSPSLSPSPSASASISEASSASETSTTQTTSTPLSSPLGTS 556
>FUT4_HUMAN (P22083) Alpha-(1,3)-fucosyltransferase (EC 2.4.1.-) (Galactoside| 3-L-fucosyltransferase) (Fucosyltransferase 4) (FUCT-IV) (Fuc-TIV) (ELAM-1 ligand fucosyltransferase) Length = 405 Score = 28.5 bits (62), Expect = 9.4 Identities = 26/75 (34%), Positives = 28/75 (37%), Gaps = 14/75 (18%) Frame = -1 Query: 453 GRRWRSGASPGGGLRGRRRWVAGRGTP--------AGTR-----TRPAWVPL-PAPWPCD 316 G W S + GG RG RR GRG P AG T W L P PW Sbjct: 2 GAPWGSPTAAAGGRRGWRR---GRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPWASP 58 Query: 315 WPSRLRRRHCWCRPW 271 PSR W P+ Sbjct: 59 TPSRPVGVLLWWEPF 73
>Y4762_ARATH (Q8RY73) Protein At4g17620, chloroplast precursor| Length = 544 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -1 Query: 444 WRSGASPGGGLRGRRRWVAGRGTPAGTRTRPAWVPLPAPWP 322 W + G G GR RW GRG P +P P P+P Sbjct: 142 WSNDNHGGRGGMGRGRWSNGRG-------GPGLLPRPGPYP 175
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 28.5 bits (62), Expect = 9.4 Identities = 18/60 (30%), Positives = 23/60 (38%), Gaps = 11/60 (18%) Frame = -1 Query: 468 RRGCQGRRWRSGASPGGGLRG-----------RRRWVAGRGTPAGTRTRPAWVPLPAPWP 322 R G G+ G S GGG G +R W + + RP +PLP P P Sbjct: 1394 RPGTGGKTGSGGGSSGGGGAGPGGRTGPGRGDKRSWPSPKNRSRPPEERPPGLPLPPPPP 1453 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,002,201 Number of Sequences: 219361 Number of extensions: 703104 Number of successful extensions: 2743 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 2606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2732 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
