ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl07g02 |
|---|---|
| Clone Library Name | barley_pub |
>NUP88_HUMAN (Q99567) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 741 Score = 34.7 bits (78), Expect = 0.13 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 172 HVIAISPLHCICACDVKRFWFLP--RPPLLFVVASTQECVRWTNLS 303 H++ PL C ++ FW +P P + + ST EC+ W LS Sbjct: 451 HILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECLIWPLLS 496
>SC5A6_DROME (P83740) Putative sodium-dependent multivitamin transporter| (Na(+)-dependent multivitamin transporter) Length = 604 Score = 33.9 bits (76), Expect = 0.22 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 3/85 (3%) Frame = +1 Query: 226 FWF---LPRPPLLFVVASTQECVRWTNLSR*PRISARTILFCTPREYCIPLSQSLINLLV 396 FW P+PPL+ + ST C + +R I +T++ E+ L + + Sbjct: 453 FWIGFGQPKPPLVSLDMSTAGCPVDRSFAR--DIFLKTVIAVAEEEHYFYLYR------I 504 Query: 397 IILWYSALGFCCCFYIGFALLYLLS 471 +WY+ALGF F+ G+ L +L + Sbjct: 505 SYMWYAALGFLITFFGGWLLSWLFA 529
>MSHR_MOUSE (Q01727) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 315 Score = 31.6 bits (70), Expect = 1.1 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Frame = +1 Query: 133 LLWSRFFTYSI*FHVIAISPLHCICACDVKRF-WFLPRPPLLFVVASTQECVRWTNLSR* 309 L W FF + + +I + P H C+C K F FL LL V++ST + + + S+ Sbjct: 250 LCWGPFFLHLL---LIVLCPQHPTCSCIFKNFNLFL----LLIVLSSTVDPLIYAFRSQE 302 Query: 310 PRISARTILFCT 345 R++ + +L C+ Sbjct: 303 LRMTLKEVLLCS 314
>NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 753 Score = 30.0 bits (66), Expect = 3.2 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 172 HVIAISPLHCICACDVKRFWFLP--RPPLLFVVASTQECV 285 H++ PL C ++ FW +P P + + ST EC+ Sbjct: 452 HILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECL 491
>NUP88_RAT (O08658) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) (Nucleoporin Nup84) Length = 742 Score = 30.0 bits (66), Expect = 3.2 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 172 HVIAISPLHCICACDVKRFWFLP--RPPLLFVVASTQECV 285 H++ PL C ++ FW +P P + + ST EC+ Sbjct: 452 HILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECL 491
>R1AB_BSCR3 (Q3I5J6) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7071 Score = 30.0 bits (66), Expect = 3.2 Identities = 22/48 (45%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 322 ARTILFCTPREYCIPLSQSLINLL-VIILWYSALGFCCCFYIG-FALL 459 AR I+F Y PL N L I+L Y LG+CCC Y G F LL Sbjct: 3730 ARAIVFVCVEYY--PLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLL 3775
>R1AB_CVHSA (P59641) Replicase polyprotein 1ab (pp1ab) (ORF1AB) [Includes:| Replicase polyprotein 1a (pp1a) (ORF1A)] [Contains: Leader protein; p65 homolog; NSP1 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); 3C-like proteinase (EC 3.4.22.-) (3CL-PRO) (3 Length = 7073 Score = 30.0 bits (66), Expect = 3.2 Identities = 22/48 (45%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +1 Query: 322 ARTILFCTPREYCIPLSQSLINLL-VIILWYSALGFCCCFYIG-FALL 459 AR I+F Y PL N L I+L Y LG+CCC Y G F LL Sbjct: 3732 ARAIVFVCVEYY--PLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLL 3777
>RS11_MYCPA (Q73S45) 30S ribosomal protein S11| Length = 138 Score = 28.9 bits (63), Expect = 7.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 48 PVKGGAASPKQGIQTQEKEPPSAPH 122 P K AA+PK+G +T+ +E + PH Sbjct: 3 PAKKAAAAPKKGQKTRRREKKNVPH 27
>LNT_CHLCV (Q824Q5) Apolipoprotein N-acyltransferase (EC 2.3.1.-) (ALP| N-acyltransferase) Length = 541 Score = 28.9 bits (63), Expect = 7.2 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +3 Query: 42 FFPVKGGAASPKQGIQTQEKEPPSAPHCSFLALVSLLYLFDLVPCDCHFS 191 FF + G A G+ EP +P S+ L SLL+L+ + HFS Sbjct: 24 FFSLLGSAVG--YGLLWYSLEPQKSPKLSWRQLTSLLFLWSVTVYGVHFS 71
>TRAR_AGRVI (P33909) Transcriptional activator protein traR| Length = 234 Score = 28.9 bits (63), Expect = 7.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 381 KRLRKRNAVFSWRAEQDRP 325 KR R R VF+W EQ+RP Sbjct: 74 KRARSRKQVFAWSGEQERP 92
>TYRO_AGABI (O42713) Tyrosinase (EC 1.14.18.1) (Monophenol monooxygenase)| (Phenolase) (Monophenol oxidase) (Cresolase) Length = 556 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 101 FFLCLDPLLWTCSTTLDREKMLWSA 27 FF DP+ W T +DR LW A Sbjct: 270 FFAAFDPIFWLHHTNVDRLLSLWKA 294
>LEU3_MYCPA (Q73VI1) 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM| dehydrogenase) (IMDH) (3-IPM-DH) Length = 336 Score = 28.5 bits (62), Expect = 9.4 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +1 Query: 28 ADQSIFSLSRVVLQVQSKGSRHRKKSLLVHR----TAASLLWSR 147 + + F + RVV+ + R RK LVH+ T A LWSR Sbjct: 148 SQNTAFGVRRVVVDAFERARRRRKHLTLVHKTNVLTFAGKLWSR 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,344,714 Number of Sequences: 219361 Number of extensions: 1153216 Number of successful extensions: 3313 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3313 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
