| Clone Name | bastl07d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BCAS1_MOUSE (Q80YN3) Breast carcinoma amplified sequence 1 homol... | 29 | 2.4 | 2 | AP3B2_MOUSE (Q9JME5) AP-3 complex subunit beta-2 (Adapter-relate... | 29 | 3.2 | 3 | AP3B2_HUMAN (Q13367) AP-3 complex subunit beta-2 (Adapter-relate... | 29 | 3.2 | 4 | RASF1_MOUSE (Q99MK9) Ras association domain-containing protein 1... | 27 | 9.3 |
|---|
>BCAS1_MOUSE (Q80YN3) Breast carcinoma amplified sequence 1 homolog (Novel| amplified in breast cancer 1 homolog) Length = 633 Score = 29.3 bits (64), Expect = 2.4 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 6 SPPPRGPDQPRTTNRSKRKEKRTPFYFPLSLIFFPSRTRSE 128 SPPP P +P + R KEK P PL +F+ + + Sbjct: 390 SPPPP-PSEPTSEGRDSGKEKAGPTSLPLGKLFWKKSVKED 429
>AP3B2_MOUSE (Q9JME5) AP-3 complex subunit beta-2 (Adapter-related protein| complex 3 beta-2 subunit) (Beta3B-adaptin) (Adaptor protein complex AP-3 beta-2 subunit) (Clathrin assembly protein complex 3 beta-2 large chain) Length = 1082 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 24 PDQPRTTNRSKRKEKRTPFY 83 P+ + +NR KRKEK PFY Sbjct: 659 PEWTKCSNREKRKEKEKPFY 678
>AP3B2_HUMAN (Q13367) AP-3 complex subunit beta-2 (Adapter-related protein| complex 3 beta-2 subunit) (Beta3B-adaptin) (Adaptor protein complex AP-3 beta-2 subunit) (AP-3 complex beta-2 subunit) (Clathrin assembly protein complex 3 beta-2 large chain) (Neu Length = 1082 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 24 PDQPRTTNRSKRKEKRTPFY 83 P+ + +NR KRKEK PFY Sbjct: 659 PEWTKCSNREKRKEKEKPFY 678
>RASF1_MOUSE (Q99MK9) Ras association domain-containing protein 1 (Protein| 123F2) Length = 340 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +3 Query: 12 PPRGPDQPRTTNRSKRKEKRTPFYFP---LSLIFFPSRTRSEK 131 PP D R T RS ++RT FY P + + SRTR+ + Sbjct: 182 PPSLQDARRGTGRSTAVKRRTSFYLPKDAIKHLHVLSRTRARE 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.129 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,016,926 Number of Sequences: 219361 Number of extensions: 404310 Number of successful extensions: 1460 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1459 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)